Product: IL6 Antibody
Catalog: DF6087
Description: Rabbit polyclonal antibody to IL6
Application: WB IHC IF/ICC
Cited expt.: WB, IHC, IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Bovine
Mol.Wt.: 24kDa; 24kD(Calculated).
Uniprot: P05231
RRID: AB_2838055

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Bovine(100%)
Clonality:
Polyclonal
Specificity:
IL6 Antibody detects endogenous levels of total IL6.
RRID:
AB_2838055
Cite Format: Affinity Biosciences Cat# DF6087, RRID:AB_2838055.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Interleukin BSF 2; B cell differentiation factor; B cell stimulatory factor 2; B-cell stimulatory factor 2; BSF 2; BSF-2; BSF2; CDF; CTL differentiation factor; Hepatocyte stimulatory factor; HGF; HSF; Hybridoma growth factor; Hybridoma growth factor Interferon beta-2; IFN-beta-2; IFNB2; IL 6; IL-6; IL6; IL6_HUMAN; Interferon beta 2; Interferon beta-2; Interleukin 6; Interleukin 6 (interferon beta 2); Interleukin BSF 2; Interleukin-6;

Immunogens

Immunogen:

A synthesized peptide derived from human IL6, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Description:
Interleukin-6 (IL-6) is a multifunctional cytokine with a wide variety of biological functions. IL-6 is implicated in the final differentiation of B-cells into immunoglobulin-secreting cells (1), myeloma and plasmacytoma growth (2), nerve cell differentiation, and activation of hepatocytes and mitogen-stimulated helper T cells (3). Upon activation, IL-6 induces at least three major signaling pathways: JAK/STAT, PI-3 kinase and MAPK (4,5).
Sequence:
MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Bovine
100
Dog
78
Pig
71
Horse
71
Sheep
71
Xenopus
0
Zebrafish
0
Chicken
0
Rabbit
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. Required for the generation of T(H)17 cells. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation.

PTMs:

N- and O-glycosylated.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the IL-6 superfamily.

Research Fields

· Cellular Processes > Cell growth and death > Cellular senescence.   (View pathway)

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Environmental Information Processing > Signal transduction > HIF-1 signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > FoxO signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > TNF signaling pathway.   (View pathway)

· Human Diseases > Drug resistance: Antineoplastic > EGFR tyrosine kinase inhibitor resistance.

· Human Diseases > Drug resistance: Antineoplastic > Antifolate resistance.

· Human Diseases > Endocrine and metabolic diseases > Insulin resistance.

· Human Diseases > Endocrine and metabolic diseases > Non-alcoholic fatty liver disease (NAFLD).

· Human Diseases > Neurodegenerative diseases > Prion diseases.

· Human Diseases > Infectious diseases: Bacterial > Salmonella infection.

· Human Diseases > Infectious diseases: Bacterial > Pertussis.

· Human Diseases > Infectious diseases: Bacterial > Legionellosis.

· Human Diseases > Infectious diseases: Parasitic > Chagas disease (American trypanosomiasis).

· Human Diseases > Infectious diseases: Parasitic > African trypanosomiasis.

· Human Diseases > Infectious diseases: Parasitic > Malaria.

· Human Diseases > Infectious diseases: Parasitic > Amoebiasis.

· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.

· Human Diseases > Infectious diseases: Viral > Hepatitis B.

· Human Diseases > Infectious diseases: Viral > Measles.

· Human Diseases > Infectious diseases: Viral > Influenza A.

· Human Diseases > Infectious diseases: Viral > HTLV-I infection.

· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.

· Human Diseases > Immune diseases > Inflammatory bowel disease (IBD).

· Human Diseases > Immune diseases > Rheumatoid arthritis.

· Human Diseases > Immune diseases > Graft-versus-host disease.

· Human Diseases > Cardiovascular diseases > Hypertrophic cardiomyopathy (HCM).

· Organismal Systems > Immune system > Toll-like receptor signaling pathway.   (View pathway)

· Organismal Systems > Immune system > NOD-like receptor signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Cytosolic DNA-sensing pathway.   (View pathway)

· Organismal Systems > Immune system > Hematopoietic cell lineage.   (View pathway)

· Organismal Systems > Immune system > IL-17 signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Th17 cell differentiation.   (View pathway)

· Organismal Systems > Immune system > Intestinal immune network for IgA production.   (View pathway)

References

1). Corynebacterium parakroppenstedtii secretes a novel glycolipid to promote the development of granulomatous lobular mastitis. Signal transduction and targeted therapy, 2024 (PubMed: 39428541) [IF=40.8]

2). Resolvin D1 delivery to lesional macrophages using antioxidative black phosphorus nanosheets for atherosclerosis treatment. Nature nanotechnology, 2024 (PubMed: 38898135) [IF=38.1]

3). An orally administered glucose-responsive polymeric complex for high-efficiency and safe delivery of insulin in mice and pigs. Nature nanotechnology, 2024 (PubMed: 39223256) [IF=38.1]

Application: IF/ICC    Species: Mouse    Sample:

Fig. 6 |. Materials retention and histological testing. a, Live-animal imaging (top) and ex vivo fluorescence imaging (bottom) of mice after oral administration of Cy5PPF-ins (50 μl; insulin-equiv. concentration, 1 mg ml−1). The major organs included heart, lung, liver, spleen and kidney (from up to down). The colour bar indicates the radiant efficiency from 1.40 × 108 to 8.66 × 108 p s−1 cm−2 sr−1 (top) and from 7.35 × 107 to 9.99 × 107 p s−1 cm−2 sr−1 (bottom). b, Representative images of TNF-α-, IL-6-, Ly6G- and TUNEL-stained intestine samples after treatment with PBS (top) or PPF-ins (1,000 U kg−1; bottom) for 2 h. Ten per cent of PPF was labelled with Cy5 (red). Scale bar, 100 μm. c, Representative images of TNF-α-, IL-6-, Ly6G- and TUNEL-stained liver samples after treatment with PBS or Cy5PPF-ins (100 U kg−1) for seven consecutive days. Scale bar, 100 μm. d–i, Haematology, biochemistry and lipids analysis in healthy mice treated with PPF-ins or PBS (n = 5 biologically independent samples, mean ± SD). Blood cell counts (d), biochemistry (e) and lipids analysis (f) of mice after treatment with PBS or PPF-ins (1,000 U kg−1) for 2 h. Blood cell counts (g), biochemistry (h) and lipids analysis (i) of mice after treatment with PBS or Cy5PPF-ins (100 U kg−1) for seven consecutive days. RBC, red blood cell; PLT, platelet; WBC, white blood cell; Neu, neutrophil; Lym, lymphocyte; Mon, monocyte; Eos, eosinophil; Bas, basophil; ALP, alkaline phosphatase; AST, aspartate transaminase; ALT, alanine transaminase; BUN, blood urea nitrogen; TC, total cholesterol; TG, triglycerides LDL-C, low-density lipoprotein cholesterol; HDL-C, high-density lipoprotein cholesterol.

4). Week-long normoglycaemia in diabetic mice and minipigs via a subcutaneous dose of a glucose-responsive insulin complex. Nature biomedical engineering, 2023 (PubMed: 38057427) [IF=26.8]

5). A biodegradable, flexible photonic patch for in vivo phototherapy. Nature Communications, 2023 (PubMed: 37244895) [IF=16.6]

6). Upregulation of BCL-2 by acridone derivative through gene promoter i-motif for alleviating liver damage of NAFLD/NASH. NUCLEIC ACIDS RESEARCH, 2020 (PubMed: 32710621) [IF=16.6]

Application: WB    Species: mouse    Sample: liver

Figure 7. Effect of A22 on ameliorating apoptosis, ER stress, inflammation, metabolic syndrome, and fibrogenesis in HF diet-fed mice. (A) Effect of A22 on BCL-2 gene transcription. (B) Effect of A22 on BAX gene transcription. (C) Effect of A22 on expressions of apoptosis-related proteins in liver. The extracted proteins from the liver were immunoblotted with specific antibodies, and quantified based on the loading control of ACTIN. (D) Effect of A22 on ER stress. The UPR proteins (IRE-1, PERK, elF-2 and CHOP) were analyzed by using western Blot. (E) Effect of A22 on expressions of inflammatory factors. (F) Effect of A22 on expressions of fibrogenic proteins.

7). Functionally integrating nanoparticles alleviate deep vein thrombosis in pregnancy and rescue intrauterine growth restriction. Nature Communications, 2022 (PubMed: 36418325) [IF=16.6]

8). Opsonization Inveigles Macrophages Engulfing Carrier-Free Bilirubin/JPH203 Nanoparticles to Suppress Inflammation for Osteoarthritis Therapy. Advanced science (Weinheim, Baden-Wurttemberg, Germany), 2024 (PubMed: 38593402) [IF=15.1]

9). Atomically precise gold nanoclusters as ROS-scavenging clusterzymes to treat high-fat diet-induced obesity. Chemical Engineering Journal, 2024 [IF=13.3]

10). Thermo-sensitive hydrogel with mussel-inspired adhesion enhanced the non-fibrotic repair effect of EGF on colonic mucosa barrier of TNBS-induced ulcerative colitis rats through macrophage polarizing. Chemical Engineering Journal, 2021 [IF=13.3]

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.