HLA-DMB Antibody - #DF9573
Product: | HLA-DMB Antibody |
Catalog: | DF9573 |
Description: | Rabbit polyclonal antibody to HLA-DMB |
Application: | WB IF/ICC |
Reactivity: | Human |
Mol.Wt.: | 29 kDa; 29kD(Calculated). |
Uniprot: | P28068 |
RRID: | AB_2842769 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9573, RRID:AB_2842769.
Fold/Unfold
class II antigen HLA-DM beta chain; class II histocompatibility antigen; Class II histocompatibility antigen M beta chain; D6S221E; DMB; HLA class II histocompatibility antigen DM beta chain; HLA-DM histocompatibility type, beta chain; M beta chain; Major histocompatibility complex class II DM beta; MHC class II antigen DMB; MHC class II antigen HLA DM beta chain; MHC class II HLA DMB; OTTHUMP00000029257; Really interesting new gene 7 protein; RING 7; RING7;
Immunogens
- P28068 DMB_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MITFLPLLLGLSLGCTGAGGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHIGAPEPILRDWTPGLSPMQTLKVSVSAVTLGLGLIIFSLGVISWRRAGHSSYTPLPGSNYSEGWHIS
PTMs - P28068 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
N110 | N-Glycosylation | Uniprot | |
T216 | Phosphorylation | Uniprot | |
Y248 | Phosphorylation | Uniprot |
Research Backgrounds
Plays a critical role in catalyzing the release of class II-associated invariant chain peptide (CLIP) from newly synthesized MHC class II molecules and freeing the peptide binding site for acquisition of antigenic peptides. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO.
Late endosome membrane>Single-pass type I membrane protein. Lysosome membrane>Single-pass type I membrane protein.
Note: Localizes to late endocytic compartment. Associates with lysosome membranes.
Heterodimer of an alpha chain (DMA) and a beta chain (DMB).
The YXXZ (Tyr-Xaa-Xaa-Zaa, where Zaa is a hydrophobic residue) motif mediates the targeting to the lysosomal compartments.
Belongs to the MHC class II family.
Research Fields
· Cellular Processes > Transport and catabolism > Phagosome. (View pathway)
· Environmental Information Processing > Signaling molecules and interaction > Cell adhesion molecules (CAMs). (View pathway)
· Human Diseases > Endocrine and metabolic diseases > Type I diabetes mellitus.
· Human Diseases > Infectious diseases: Parasitic > Leishmaniasis.
· Human Diseases > Infectious diseases: Parasitic > Toxoplasmosis.
· Human Diseases > Infectious diseases: Bacterial > Staphylococcus aureus infection.
· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.
· Human Diseases > Infectious diseases: Viral > Influenza A.
· Human Diseases > Infectious diseases: Viral > HTLV-I infection.
· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.
· Human Diseases > Immune diseases > Asthma.
· Human Diseases > Immune diseases > Autoimmune thyroid disease.
· Human Diseases > Immune diseases > Inflammatory bowel disease (IBD).
· Human Diseases > Immune diseases > Systemic lupus erythematosus.
· Human Diseases > Immune diseases > Rheumatoid arthritis.
· Human Diseases > Immune diseases > Allograft rejection.
· Human Diseases > Immune diseases > Graft-versus-host disease.
· Human Diseases > Cardiovascular diseases > Viral myocarditis.
· Organismal Systems > Immune system > Antigen processing and presentation. (View pathway)
· Organismal Systems > Immune system > Hematopoietic cell lineage. (View pathway)
· Organismal Systems > Immune system > Th1 and Th2 cell differentiation. (View pathway)
· Organismal Systems > Immune system > Th17 cell differentiation. (View pathway)
· Organismal Systems > Immune system > Intestinal immune network for IgA production. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.