Phospho-c-Fos (Ser362) Antibody - #AF3053

(4)   (4)  
Product: Phospho-c-Fos (Ser362) Antibody
Catalog: AF3053
Description: Rabbit polyclonal antibody to Phospho-c-Fos (Ser362)
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 40kDa; 41kD(Calculated).
Uniprot: P01100
RRID: AB_2834480

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Rabbit(100%), Dog(100%), Chicken(100%), Xenopus(83%)
Clonality:
Polyclonal
Specificity:
Phospho-c-Fos (Ser362) Antibody detects endogenous levels of c-Fos only when phosphorylated at Serine 362.
RRID:
AB_2834480
Cite Format: Affinity Biosciences Cat# AF3053, RRID:AB_2834480.
Conjugate:
Unconjugated.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Activator protein 1; AP 1; C FOS; Cellular oncogene c fos; Cellular oncogene fos; FBJ murine osteosarcoma viral (v fos) oncogene homolog (oncogene FOS); FBJ murine osteosarcoma viral oncogene homolog; FBJ murine osteosarcoma viral v fos oncogene homolog; FBJ Osteosarcoma Virus; FOS; FOS protein; FOS_HUMAN; G0 G1 switch regulatory protein 7; G0/G1 switch regulatory protein 7; G0S7; Oncogene FOS; p55; proto oncogene c Fos; Proto oncogene protein c fos; Proto-oncogene c-Fos; v fos FBJ murine osteosarcoma viral oncogene homolog;

Immunogens

Immunogen:
Uniprot:

P01100(FOS_HUMAN) >>Visit HPA database.

Gene(ID):
FOS(2353)
Description:
The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of the FOS gene has also been associated with apoptotic cell death.
Sequence:
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Dog
100
Chicken
100
Rabbit
100
Xenopus
83
Sheep
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P01100 As Substrate

Site PTM Type Enzyme
Y10 Phosphorylation
Y30 Phosphorylation
S32 Phosphorylation Q13164 (MAPK7)
S70 Phosphorylation
K113 Sumoylation
K113 Ubiquitination
T114 Phosphorylation
T116 Phosphorylation
K128 Sumoylation
S133 Phosphorylation
K139 Sumoylation
K176 Sumoylation
K188 Ubiquitination
T232 Phosphorylation Q13164 (MAPK7) , P27361 (MAPK3) , P28482 (MAPK1)
S258 Phosphorylation
S261 Phosphorylation
K265 Sumoylation
S278 Phosphorylation
S308 Phosphorylation O14920 (IKBKB)
T325 Phosphorylation P27361 (MAPK3) , P28482 (MAPK1)
T331 Phosphorylation P28482 (MAPK1) , P27361 (MAPK3)
S362 Phosphorylation O75676 (RPS6KA4) , Q15418 (RPS6KA1)
S363 Phosphorylation
S374 Phosphorylation P28482 (MAPK1) , P27361 (MAPK3)
T376 Phosphorylation

Research Backgrounds

Function:

Nuclear phosphoprotein which forms a tight but non-covalently linked complex with the JUN/AP-1 transcription factor. In the heterodimer, FOS and JUN/AP-1 basic regions each seems to interact with symmetrical DNA half sites. On TGF-beta activation, forms a multimeric SMAD3/SMAD4/JUN/FOS complex at the AP1/SMAD-binding site to regulate TGF-beta-mediated signaling. Has a critical function in regulating the development of cells destined to form and maintain the skeleton. It is thought to have an important role in signal transduction, cell proliferation and differentiation. In growing cells, activates phospholipid synthesis, possibly by activating CDS1 and PI4K2A. This activity requires Tyr-dephosphorylation and association with the endoplasmic reticulum.

PTMs:

Phosphorylated in the C-terminal upon stimulation by nerve growth factor (NGF) and epidermal growth factor (EGF). Phosphorylated, in vitro, by MAPK and RSK1. Phosphorylation on both Ser-362 and Ser-374 by MAPK1/2 and RSK1/2 leads to protein stabilization with phosphorylation on Ser-374 being the major site for protein stabilization on NGF stimulation. Phosphorylation on Ser-362 and Ser-374 primes further phosphorylations on Thr-325 and Thr-331 through promoting docking of MAPK to the DEF domain. Phosphorylation on Thr-232, induced by HA-RAS, activates the transcriptional activity and antagonizes sumoylation. Phosphorylation on Ser-362 by RSK2 in osteoblasts contributes to osteoblast transformation (By similarity).

Constitutively sumoylated with SUMO1, SUMO2 and SUMO3. Desumoylated by SENP2. Sumoylation requires heterodimerization with JUN and is enhanced by mitogen stimulation. Sumoylation inhibits the AP-1 transcriptional activity and is, itself, inhibited by Ras-activated phosphorylation on Thr-232.

In quiescent cells, the small amount of FOS present is phosphorylated at Tyr-10 and Tyr-30 by SRC. This Tyr-phosphorylated form is cytosolic. In growing cells, dephosphorylated by PTPN2. Dephosphorylation leads to the association with endoplasmic reticulum membranes and activation of phospholipid synthesis.

Subcellular Location:

Nucleus. Endoplasmic reticulum. Cytoplasm>Cytosol.
Note: In quiescent cells, present in very small amounts in the cytosol. Following induction of cell growth, first localizes to the endoplasmic reticulum and only later to the nucleus. Localization at the endoplasmic reticulum requires dephosphorylation at Tyr-10 and Tyr-30.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Heterodimer; with JUN (By similarity). Interacts with MAFB (By similarity). Component of the SMAD3/SMAD4/JUN/FOS complex required for synergistic TGF-beta-mediated transcription at the AP1 promoter site. Interacts with SMAD3; the interaction is weak even on TGF-beta activation. Interacts with MAFB. Interacts with DSIPI; this interaction inhibits the binding of active AP1 to its target DNA. Interacts with CDS1 and PI4K2A (By similarity).

Family&Domains:

Belongs to the bZIP family. Fos subfamily.

References

1). JNK signaling pathway mediates acetaminophen-induced hepatotoxicity accompanied by changes of glutathione S-transferase A1 content and expression. Frontiers in Pharmacology (PubMed: 31620005) [IF=5.6]

Application: WB    Species: mouse    Sample: liver

FIGURE 2 | Activation of JNK signaling pathway under different dosages of APAP. (A) Western blot analyses of total tissue lysate for p-JNK, JNK, p-c-Jun, c-Jun,p-c-Fos, c-Fos, and β-actin (loading control).
2). Protective Effects of ζ-Carotene-like Compounds against Acute UVB-Induced Skin Damage. International journal of molecular sciences (PubMed: 37762273) [IF=5.6]

Application: WB    Species: Mouse    Sample:

Figure 7 MAPK/AP-1 signaling pathway. (A) is the representative blots. (B–K) are the ratios of JNK, ERK, P38, Jun, c-FOS, p-JNK, p-ERK, p-P38, p-Jun and p-c-FOS to GAPDH (n = 3, ## p < 0.01 vs. the NCS group and * p < 0.05, ** p < 0.01 vs. the MCS group and ns is no significance).
3). Baicalin enhances the thermotolerance of mouse blastocysts by activating the ERK1/2 signaling pathway and preventing mitochondrial dysfunction. Theriogenology (PubMed: 34808561) [IF=2.8]
4). Prevention of acetaminophen-induced hepatocyte injury: JNK inhibition and GSTA1 involvement. Molecular & Cellular Toxicology [IF=1.7]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.