Cyclin A Antibody | Affinity Biosciences

Product:	Cyclin A Antibody
Catalog:	AF0142
Description:	Rabbit polyclonal antibody to Cyclin A
Application:	WB IHC IF/ICC
Reactivity:	Human, Mouse, Rat, Monkey
Prediction:	Pig, Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.:	53kDa; 52kD,49kD(Calculated).
Uniprot:	P78396 \| P20248
RRID:	AB_2833324

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
100ul	$280	In stock
200ul	$350	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

WB 1:500-1:3000, IHC 1:50-1:200, IF/ICC: 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human,Mouse,Rat,Monkey

Prediction:

Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%)

Clonality:

Polyclonal

Specificity:

Cyclin A Antibody detects endogenous levels of total Cyclin A.

RRID:

AB_2833324
Cite Format: Affinity Biosciences Cat# AF0142, RRID:AB_2833324.

Conjugate:

Unconjugated.

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

CCN A1; CCNA 1; Ccna1; CCNA1_HUMAN; Cyclin-A1; CyclinA1; G2/mitotic specific cyclin A1; MGC132235; MGC159139; CCN1; CCNA; Ccna2; CCNA2_HUMAN; Cyclin A2; Cyclin-A; Cyclin-A2;

Immunogens

Immunogen:

Uniprot:

P78396(CCNA1_HUMAN) >>Visit HPA database.

P20248(CCNA2_HUMAN) >>Visit HPA database.

Gene(ID):

CCNA2(890) | CCNA1(8900)

Expression:

P78396 CCNA1_HUMAN:

Very high levels in testis and very low levels in brain. Also found in myeloid leukemia cell lines.

Description:

CCNA1 May be involved in the control of the cell cycle at the G1/S (start) and G2/M (mitosis) transitions. May primarily function in the control of the germline meiotic cell cycle and additionally in the control of mitotic cell cycle in some somatic cells. Belongs to the cyclin family；CCNA2 a member of the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle.

Sequence:

P78396 CCNA1_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQQPVESEAMHCSNPKSGVVLATVARGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKKALPDCGVQEPPKQGFDIYMDELEQGDRDSCSVREGMAFEDVYEVDTGTLKSDLHFLLDFNTVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDITEGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKYEEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIVPCLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPPAVLLLQ

P20248 CCNA2_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MLGNSAPGPATREAGSALLALQQTALQEDQENINPEKAAPVQQPRTRAALAVLKSGNPRGLAQQQRPKTRRVAPLKDLPVNDEHVTVPPWKANSKQPAFTIHVDEAEKEAQKKPAESQKIEREDALAFNSAISLPGPRKPLVPLDYPMDGSFESPHTMDMSIILEDEKPVSVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species

Results

Score

Pig

100

Horse

100

Bovine

100

Sheep

100

Dog

100

Rabbit

100

Xenopus

Zebrafish

Chicken

Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P78396/P20248 As Substrate

P78396
P20248

Site	PTM Type	Source
	Ubiquitination	Uniprot
T168	Phosphorylation	Uniprot
S280	Phosphorylation	Uniprot

Site	PTM Type	Enzyme	Source
	Ubiquitination		Uniprot
M1	Acetylation		Uniprot
S5	Phosphorylation		Uniprot
K37	Ubiquitination		Uniprot
K54	Acetylation		Uniprot
K54	Ubiquitination		Uniprot
S55	Phosphorylation		Uniprot
K68	Acetylation		Uniprot
K76	Acetylation		Uniprot
K95	Acetylation		Uniprot
K95	Ubiquitination		Uniprot
K112	Acetylation		Uniprot
Y146	Phosphorylation		Uniprot
S151	Phosphorylation		Uniprot
S154	Phosphorylation	P24941 (CDK2)	Uniprot
K192	Ubiquitination		Uniprot
S209	Phosphorylation		Uniprot
Y225	Phosphorylation		Uniprot
S244	Phosphorylation		Uniprot
T380	Phosphorylation		Uniprot
K388	Ubiquitination		Uniprot
K400	Ubiquitination		Uniprot
K417	Ubiquitination		Uniprot

Research Backgrounds

P78396_CCNA1_HUMAN
P20248_CCNA2_HUMAN

Function:

May be involved in the control of the cell cycle at the G1/S (start) and G2/M (mitosis) transitions. May primarily function in the control of the germline meiotic cell cycle and additionally in the control of mitotic cell cycle in some somatic cells.

PTMs:

Polyubiquitinated via 'Lys-11'-linked ubiquitin by the anaphase-promoting complex (APC/C), leading to its degradation by the proteasome. Deubiquitinated and stabilized by USP37 enables entry into S phase.

Subcellular Location:

Nucleus.

Tissue Specificity:

Very high levels in testis and very low levels in brain. Also found in myeloid leukemia cell lines.

Subunit Structure:

Interacts with the CDK2 and the CDC2 protein kinases to form a serine/threonine kinase holoenzyme complex. The cyclin subunit imparts substrate specificity to the complex. Does not bind CDK4 and CDK5 (in vitro). The cyclin A1-CDK2 complex interacts with transcription factor E2F-1 and RB proteins. Found in a complex with CDK2, CABLES1 and CCNE1 (By similarity). Interacts with INCA1. Interacts with KLHDC9.

Family&Domains:

Belongs to the cyclin family. Cyclin AB subfamily.

Function:

Cyclin which controls both the G1/S and the G2/M transition phases of the cell cycle. Functions through the formation of specific serine/threonine protein kinase holoenzyme complexes with the cyclin-dependent protein kinases CDK1 or CDK2. The cyclin subunit confers the substrate specificity of these complexes and differentially interacts with and activates CDK1 and CDK2 throughout the cell cycle.

PTMs:

Subcellular Location:

Nucleus. Cytoplasm.
Note: Exclusively nuclear during interphase (PubMed:1312467). Detected in the nucleus and the cytoplasm at prophase (PubMed:1312467). Cytoplasmic when associated with SCAPER (PubMed:17698606).

Subunit Structure:

Interacts with the CDK1 and CDK2 protein kinases to form serine/threonine kinase holoenzyme complexes. Interacts with CDK1 (hyperphosphorylated form in G1 and underphosphorylated forms in S and G2). Interacts with CDK2; the interaction increases from G1 to G2. Interacts (associated with CDK2 but not with CDK1) with SCAPER; regulates the activity of CCNA2/CDK2 by transiently maintaining CCNA2 in the cytoplasm. Forms a ternary complex with CDK2 and CDKN1B; CDKN1B inhibits the kinase activity of CDK2 through conformational rearrangements. Interacts with INCA1.

(Microbial infection) Interacts with human cytomegalovirus protein UL32.

Family&Domains:

Belongs to the cyclin family. Cyclin AB subfamily.

Research Fields

· Cellular Processes > Cell growth and death > Cell cycle. (View pathway)

· Cellular Processes > Cell growth and death > Cellular senescence. (View pathway)

· Environmental Information Processing > Signal transduction > AMPK signaling pathway. (View pathway)

· Human Diseases > Infectious diseases: Viral > Hepatitis B.

· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.

· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.

· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)

· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.

· Human Diseases > Cancers: Overview > Viral carcinogenesis.

· Human Diseases > Cancers: Specific types > Acute myeloid leukemia. (View pathway)

· Organismal Systems > Endocrine system > Progesterone-mediated oocyte maturation.

References

1). TCA-phospholipid-glycolysis targeted triple therapy effectively suppresses ATP production and tumor growth in glioblastoma. Theranostics, 2023 (PubMed: 36276638) [IF=12.4]

Application: WB Species: Human Sample: TBD0220 and U87MG cells

Figure 3 Reduction in ATP production hinders cell proliferation and contributes to G1/S arrest in GBM. (A-B) The relative viability of TBD0220 (A) and U87MG (B) cells was measured using a CCK-8 kit (n = 3). (C-D) Colony formation assay to detect GBM cell growth (D), and the quantification of colony numbers (C) (n = 3). (E) Cell cycle analysis using flow cytometry after incubation with different treatments like EPIC (20 µM), AA (25 µM), or EPIC (20 µM) + AA (25 µM) for 48 h, and the results are plotted as a histogram (n = 3) (F) Representative western blotting showing the expression of p21 and Rb and their downstream targets. The results were normalized to Tubulin with the control group as 1. Protein expression was quantified by ImageJ. (G) Representative confocal images of CDK6 after the treatment with AA (25 µM), EPIC (20 µM), or EPIC (20 µM) + AA (25 µM) for 48 h (n = 6). (H) The quantitative analysis of fluorescence images of CDK6 (n = 6). All data are shown as the mean values ± SD, and p values are based on one-way or two-way ANOVA. ****p < 0.0001, ***p < 0.001, **p < 0.01, *p < 0.05. Scale bar = 20 μm.

2). Combination LSD1 and HOTAIR-EZH2 inhibition disrupts cell cycle processes and induces apoptosis in glioblastoma cells. PHARMACOLOGICAL RESEARCH, 2021 (PubMed: 34246782) [IF=9.3]

3). Quercetin induces MGMT+ glioblastoma cells apoptosis via dual inhibition of Wnt3a/β-Catenin and Akt/NF-κB signaling pathways. Phytomedicine, 2023 (PubMed: 37451151) [IF=7.9]

4). Isobavachalcone, a natural sirtuin 2 inhibitor, exhibits anti-triple-negative breast cancer efficacy in vitro and in vivo. Phytotherapy research : PTR, 2024 (PubMed: 38349045) [IF=7.2]

5). Trans-anethole ameliorates LPS-induced inflammation via suppression of TLR4/NF-κB pathway in IEC-6 cells. International Immunopharmacology, 2022 (PubMed: 35617845) [IF=5.6]

6). The receptor for activated protein kinase C promotes cell growth, invasion and migration in cervical cancer. INTERNATIONAL JOURNAL OF ONCOLOGY, 2017 (PubMed: 29048616) [IF=5.2]

Application: WB Species: human Sample:

7). High Iodine Induces the Proliferation of Papillary and Anaplastic Thyroid Cancer Cells via AKT/Wee1/CDK1 Axis. Frontiers in Oncology, 2021 (PubMed: 33796458) [IF=4.7]

8). CD38 enhances the proliferation and inhibits the apoptosis of cervical cancer cells by affecting the mitochondria functions. MOLECULAR CARCINOGENESIS, 2017 (PubMed: 28544069) [IF=4.6]

Application: WB Species: human Sample:

Western blot analysis indicated that CD38 correlated with P53/P21/cyclinD1 pathway

9). Ovostatin 2 knockdown significantly inhibits the growth, migration, and tumorigenicity of cutaneous malignant melanoma cells. PLoS One, 2018 (PubMed: 29684087) [IF=3.7]

Application: WB Species: mouse Sample: A375 cells

Fig 5. |Western blot results. (a) The levels of cyclin A, cyclin B, cyclin D1, and CDK2 were reduced in A375 cells transfected with OVOS2-shRNA

10). Regulation of the PTEN/PI3K/AKT pathway in RCC using the active compounds of natural products in vitro. Molecular Medicine Reports, 2021 (PubMed: 34490473) [IF=3.4]

Application: WB Species: human Sample: 786‑O and OS‑RC‑2 cells

Figure 3.| Naringenin arrests cell cycle progression of renal cell carcinoma cells in the G2 phase. 786‑O and OS‑RC‑2 cells were treated with naringenin (0, 4 or 8 µM) for 48 h. (A) Cell cycle distribution was determined using flow cytometry. (B) Western blot analysis of cyclin E1, cyclin A2, cyclin B1, cyclin D1, P27 and P21 expression levels. Data are presented as the mean ± SD. * P<0.05, **P<0.01 vs. Abs. Abs, absolute ethanol.

Application: WB Species: Human Sample: 786-O and OS-RC-2 cells

Figure 3. Naringenin arrests cell cycle progression of renal cell carcinoma cells in the G2 phase. 786-O and OS-RC-2 cells were treated with naringenin (0, 4 or 8 µM) for 48 h. (A) Cell cycle distribution was determined using flow cytometry. (B) Western blot analysis of cyclin E1, cyclin A2, cyclin B1, cyclin D1, P27 and P21 expression levels. Data are presented as the mean ± SD. *P<0.05, **P<0.01 vs. Abs. Abs, absolute ethanol.

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

Cyclin A Antibody - #AF0142