TCEB1 Antibody - #DF2373
| Product: | TCEB1 Antibody |
| Catalog: | DF2373 |
| Description: | Rabbit polyclonal antibody to TCEB1 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Dog, Chicken, Xenopus |
| Mol.Wt.: | 12 kDa; 12kD(Calculated). |
| Uniprot: | Q15369 |
| RRID: | AB_2839581 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2373, RRID:AB_2839581.
Fold/Unfold
Elo C; EloC; ELOC_HUMAN; Elongin 15 kDa subunit; Elongin C; Elongin-C; ElonginC; RNA polymerase II transcription factor SIII subunit C; SIII; SIII p15; TCEB 1; tceb1; Transcription elongation factor B (SIII) polypeptide 1; Transcription elongation factor B polypeptide 1;
Immunogens
Overexpressed in prostate cancer cell line PC-3 and breast cancer cell line SK-BR-3.
- Q15369 ELOC_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q15369 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K6 | Ubiquitination | Uniprot | |
| C11 | S-Nitrosylation | Uniprot | |
| Y18 | Phosphorylation | Uniprot | |
| K20 | Ubiquitination | Uniprot | |
| S24 | Phosphorylation | Uniprot | |
| K32 | Acetylation | Uniprot | |
| K32 | Sumoylation | Uniprot | |
| K32 | Ubiquitination | Uniprot | |
| T38 | Phosphorylation | Uniprot | |
| K43 | Ubiquitination | Uniprot | |
| S47 | Phosphorylation | Uniprot | |
| K72 | Acetylation | Uniprot | |
| K72 | Ubiquitination | Uniprot |
PTMs - Q15369 As Enzyme
| Substrate | Site | Source |
|---|---|---|
| Q02539 (HIST1H1A) | S183 | Uniprot |
Research Backgrounds
SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex). In embryonic stem cells, the elongin BC complex is recruited by EPOP to Polycomb group (PcG) target genes in order generate genomic region that display both active and repressive chromatin properties, an important feature of pluripotent stem cells (By similarity).
The elongin BC complex seems to be involved as an adapter protein in the proteasomal degradation of target proteins via different E3 ubiquitin ligase complexes, including the von Hippel-Lindau ubiquitination complex CBC(VHL). By binding to BC-box motifs it seems to link target recruitment subunits, like VHL and members of the SOCS box family, to Cullin/RBX1 modules that activate E2 ubiquitination enzymes.
Nucleus.
Overexpressed in prostate cancer cell line PC-3 and breast cancer cell line SK-BR-3.
Heterotrimer of an A (ELOA, ELOA2 or ELOA3), ELOB and ELOC subunit. The elongin BC complex interacts with EPOP; leading to recruit the elongin BC complex to Polycomb group (PcG) target genes, thereby restricting excessive activity of the PRC2/EED-EZH2 complex (By similarity). Part of E3 ubiquitin ligase complexes with CUL5 or CUL2, RBX1 and a substrate adapter protein that can be either SOCS1, SOCS5, ELOA, VHL or WSB1. The elongin BC complex is part of a complex with VHL and hydroxylated HIF1A. Part of an E3 ubiquitin-protein ligase complex including ZYG11B, CUL2 and Elongin BC. Part of an E3 ubiquitin-protein ligase complex including ZER1, CUL2 and Elongin BC. Interacts with VHL. Interacts with TMF1. Interacts with SPSB1. Interacts with SPSB1. Interacts with KLHDC10; which may be an E3 ubiquitin ligase complex substrate recognition component. Interacts with NOS2 in the presence of SPSB1 or SPSB2 or SPSB4.
(Microbial infection) Substrate adapter protein can be a viral protein such as HIV Vif.
(Microbial infection) Interacts with human respiratory syncytial virus (HRSV) protein NS1.
(Microbial infection) Interacts with molluscum contagiosum virus MC132.
(Microbial infection) Interacts with herpes virus 8 virus protein LANA1.
Belongs to the SKP1 family.
Research Fields
· Environmental Information Processing > Signal transduction > HIF-1 signaling pathway. (View pathway)
· Genetic Information Processing > Folding, sorting and degradation > Ubiquitin mediated proteolysis. (View pathway)
· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)
· Human Diseases > Cancers: Specific types > Renal cell carcinoma. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.