MAPK13 Antibody - #DF2360
| Product: | MAPK13 Antibody |
| Catalog: | DF2360 |
| Description: | Rabbit polyclonal antibody to MAPK13 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Sheep, Rabbit, Dog |
| Mol.Wt.: | 42 kDa; 42kD(Calculated). |
| Uniprot: | O15264 |
| RRID: | AB_2839568 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2360, RRID:AB_2839568.
Fold/Unfold
MAP kinase 13; MAP kinase p38 delta; MAPK 13; MAPK-13; Mapk13; MGC99536; Mitogen activated protein kinase 13; Mitogen-activated protein kinase 13; Mitogen-activated protein kinase p38 delta; MK13_HUMAN; OTTHUMP00000016282; OTTHUMP00000016283; p38 delta; P38delta; PRKM13; SAPK 4; SAPK4; Stress activated protein kinase 4; Stress-activated protein kinase 4;
Immunogens
Expressed in testes, pancreas, small intestine, lung and kidney. Abundant in macrophages, also present in neutrophils, CD4+ T-cells, and endothelial cells.
- O15264 MK13_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O15264 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Y10 | Phosphorylation | Uniprot | |
| S27 | Phosphorylation | Uniprot | |
| S47 | Phosphorylation | Uniprot | |
| S143 | Phosphorylation | Uniprot | |
| T180 | Phosphorylation | P52564 (MAP2K6) , P46734 (MAP2K3) | Uniprot |
| Y182 | Phosphorylation | P52564 (MAP2K6) , P46734 (MAP2K3) | Uniprot |
| T185 | Phosphorylation | Uniprot | |
| K226 | Ubiquitination | Uniprot | |
| S261 | Phosphorylation | Uniprot | |
| T265 | Phosphorylation | Uniprot | |
| S350 | Phosphorylation | Uniprot | |
| S357 | Phosphorylation | Uniprot | |
| S361 | Phosphorylation | Uniprot |
PTMs - O15264 As Enzyme
| Substrate | Site | Source |
|---|---|---|
| O00418 (EEF2K) | S359 | Uniprot |
| O00418 (EEF2K) | S396 | Uniprot |
| P04637 (TP53) | S33 | Uniprot |
| P04637 (TP53) | S46 | Uniprot |
| P05787 (KRT8) | S74 | Uniprot |
| P10636-8 (MAPT) | T50 | Uniprot |
| P10636-8 (MAPT) | T69 | Uniprot |
| P10636-8 (MAPT) | T153 | Uniprot |
| P10636-8 (MAPT) | S202 | Uniprot |
| P10636-8 (MAPT) | T205 | Uniprot |
| P10636-8 (MAPT) | T212 | Uniprot |
| P10636-8 (MAPT) | T217 | Uniprot |
| P10636-8 (MAPT) | S235 | Uniprot |
| P10636-8 (MAPT) | S396 | Uniprot |
| P10636-8 (MAPT) | S404 | Uniprot |
| P10636-8 (MAPT) | S422 | Uniprot |
| P16949 (STMN1) | S25 | Uniprot |
| P16949 (STMN1) | S38 | Uniprot |
| P30281 (CCND3) | T283 | Uniprot |
| P78352 (DLG4) | T287 | Uniprot |
| Q13501 (SQSTM1) | T269 | Uniprot |
| Q13501 (SQSTM1) | S272 | Uniprot |
| Q14934 (NFATC4) | S168 | Uniprot |
| Q14934 (NFATC4) | S170 | Uniprot |
| Q15139 (PRKD1) | S208 | Uniprot |
| Q15139 (PRKD1) | S249 | Uniprot |
| Q15139 (PRKD1) | S397 | Uniprot |
| Q15139 (PRKD1) | S401 | Uniprot |
| Q15139 (PRKD1) | S742 | Uniprot |
| Q8IW41 (MAPKAPK5) | T182 | Uniprot |
| Q8NHW3 (MAFA) | T57 | Uniprot |
| Q8NHW3 (MAFA) | T134 | Uniprot |
| Q8NHW3 (MAFA) | S336 | Uniprot |
Research Backgrounds
Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK13 is one of the four p38 MAPKs which play an important role in the cascades of cellular responses evoked by extracellular stimuli such as proinflammatory cytokines or physical stress leading to direct activation of transcription factors such as ELK1 and ATF2. Accordingly, p38 MAPKs phosphorylate a broad range of proteins and it has been estimated that they may have approximately 200 to 300 substrates each. MAPK13 is one of the less studied p38 MAPK isoforms. Some of the targets are downstream kinases such as MAPKAPK2, which are activated through phosphorylation and further phosphorylate additional targets. Plays a role in the regulation of protein translation by phosphorylating and inactivating EEF2K. Involved in cytoskeletal remodeling through phosphorylation of MAPT and STMN1. Mediates UV irradiation induced up-regulation of the gene expression of CXCL14. Plays an important role in the regulation of epidermal keratinocyte differentiation, apoptosis and skin tumor development. Phosphorylates the transcriptional activator MYB in response to stress which leads to rapid MYB degradation via a proteasome-dependent pathway. MAPK13 also phosphorylates and down-regulates PRKD1 during regulation of insulin secretion in pancreatic beta cells.
Dually phosphorylated on Thr-180 and Tyr-182 by MAP2K3/MKK3, MAP2K4/MKK4, MAP2K6/MKK6 and MAP2K7/MKK7, which activates the enzyme. Dephosphorylated by dual specificity phosphatase DUSP1.
Expressed in testes, pancreas, small intestine, lung and kidney. Abundant in macrophages, also present in neutrophils, CD4+ T-cells, and endothelial cells.
Interacts with MAPK8IP2.
The TXY motif contains the threonine and tyrosine residues whose phosphorylation activates the MAP kinases.
Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
Research Fields
· Cellular Processes > Cell growth and death > Cellular senescence. (View pathway)
· Cellular Processes > Cellular community - eukaryotes > Signaling pathways regulating pluripotency of stem cells. (View pathway)
· Environmental Information Processing > Signal transduction > MAPK signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Rap1 signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > FoxO signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Sphingolipid signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > TNF signaling pathway. (View pathway)
· Human Diseases > Drug resistance: Antineoplastic > Endocrine resistance.
· Human Diseases > Neurodegenerative diseases > Amyotrophic lateral sclerosis (ALS).
· Human Diseases > Infectious diseases: Bacterial > Epithelial cell signaling in Helicobacter pylori infection.
· Human Diseases > Infectious diseases: Bacterial > Shigellosis.
· Human Diseases > Infectious diseases: Bacterial > Salmonella infection.
· Human Diseases > Infectious diseases: Bacterial > Pertussis.
· Human Diseases > Infectious diseases: Parasitic > Leishmaniasis.
· Human Diseases > Infectious diseases: Parasitic > Chagas disease (American trypanosomiasis).
· Human Diseases > Infectious diseases: Parasitic > Toxoplasmosis.
· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.
· Human Diseases > Infectious diseases: Viral > Hepatitis C.
· Human Diseases > Infectious diseases: Viral > Influenza A.
· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.
· Human Diseases > Cancers: Overview > Proteoglycans in cancer.
· Organismal Systems > Circulatory system > Adrenergic signaling in cardiomyocytes. (View pathway)
· Organismal Systems > Development > Osteoclast differentiation. (View pathway)
· Organismal Systems > Immune system > Platelet activation. (View pathway)
· Organismal Systems > Immune system > Toll-like receptor signaling pathway. (View pathway)
· Organismal Systems > Immune system > NOD-like receptor signaling pathway. (View pathway)
· Organismal Systems > Immune system > RIG-I-like receptor signaling pathway. (View pathway)
· Organismal Systems > Immune system > IL-17 signaling pathway. (View pathway)
· Organismal Systems > Immune system > Th1 and Th2 cell differentiation. (View pathway)
· Organismal Systems > Immune system > Th17 cell differentiation. (View pathway)
· Organismal Systems > Immune system > T cell receptor signaling pathway. (View pathway)
· Organismal Systems > Immune system > Fc epsilon RI signaling pathway. (View pathway)
· Organismal Systems > Immune system > Leukocyte transendothelial migration. (View pathway)
· Organismal Systems > Nervous system > Neurotrophin signaling pathway. (View pathway)
· Organismal Systems > Nervous system > Retrograde endocannabinoid signaling. (View pathway)
· Organismal Systems > Nervous system > Dopaminergic synapse.
· Organismal Systems > Sensory system > Inflammatory mediator regulation of TRP channels. (View pathway)
· Organismal Systems > Endocrine system > Progesterone-mediated oocyte maturation.
· Organismal Systems > Endocrine system > Prolactin signaling pathway. (View pathway)
· Organismal Systems > Endocrine system > Relaxin signaling pathway.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.