MAPK12 Antibody - #DF2359
Product: | MAPK12 Antibody |
Catalog: | DF2359 |
Description: | Rabbit polyclonal antibody to MAPK12 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus |
Mol.Wt.: | 42 kDa; 42kD(Calculated). |
Uniprot: | P53778 |
RRID: | AB_2839567 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2359, RRID:AB_2839567.
Fold/Unfold
ERK 6; ERK-6; ERK6; Extracellular signal-regulated kinase 6; MAP kinase 12; MAP kinase p38 gamma; MAPK 12; Mapk12; Mitogen Activated Protein Kinase 12; Mitogen activated protein kinase p38 gamma; Mitogen-activated protein kinase 12; Mitogen-activated protein kinase p38 gamma; MK12_HUMAN; P38 GAMMA; P38GAMMA; PRKM12; SAPK 3; SAPK-3; SAPK3; Stress Activated Protein Kinase 3; Stress-activated protein kinase 3;
Immunogens
- P53778 MK12_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P53778 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S3 | Phosphorylation | P53778 (MAPK12) | Uniprot |
Y27 | Phosphorylation | Uniprot | |
S180 | Phosphorylation | Uniprot | |
T183 | Phosphorylation | P46734 (MAP2K3) , P45985 (MAP2K4) , P52564 (MAP2K6) | Uniprot |
Y185 | Phosphorylation | P46734 (MAP2K3) , P45985 (MAP2K4) , P52564 (MAP2K6) | Uniprot |
K236 | Ubiquitination | Uniprot | |
S362 | Phosphorylation | Uniprot |
PTMs - P53778 As Enzyme
Substrate | Site | Source |
---|---|---|
O00418 (EEF2K) | S396 | Uniprot |
O43464 (HTRA2) | S142 | Uniprot |
O60239-2 (SH3BP5) | S194 | Uniprot |
O60239-2 (SH3BP5) | S264 | Uniprot |
O60239-1 (SH3BP5) | S351 | Uniprot |
O60239-1 (SH3BP5) | S421 | Uniprot |
P05787 (KRT8) | S74 | Uniprot |
P10636-8 (MAPT) | T50 | Uniprot |
P10636-8 (MAPT) | T69 | Uniprot |
P10636-6 (MAPT) | T123 | Uniprot |
P10636-2 (MAPT) | S144 | Uniprot |
P10636-6 (MAPT) | T147 | Uniprot |
P10636-8 (MAPT) | T153 | Uniprot |
P10636-6 (MAPT) | T173 | Uniprot |
P10636-8 (MAPT) | T181 | Uniprot |
P10636-8 (MAPT) | S202 | Uniprot |
P10636-8 (MAPT) | T205 | Uniprot |
P10636-2 (MAPT) | S231 | Uniprot |
P10636-8 (MAPT) | T231 | Uniprot |
P10636-8 (MAPT) | S235 | Uniprot |
P10636-6 (MAPT) | S262 | Uniprot |
P10636-8 (MAPT) | S320 | Uniprot |
P10636-8 (MAPT) | S396 | Uniprot |
P10636-8 (MAPT) | S404 | Uniprot |
P10636-8 (MAPT) | S422 | Uniprot |
P11388 (TOP2A) | S1525 | Uniprot |
P15172 (MYOD1) | S200 | Uniprot |
P15172 (MYOD1) | S201 | Uniprot |
P15336 (ATF2) | T69 | Uniprot |
P15336 (ATF2) | T71 | Uniprot |
P15336 (ATF2) | S90 | Uniprot |
P16949 (STMN1) | S25 | Uniprot |
P26045 (PTPN3) | S459 | Uniprot |
P30281 (CCND3) | T283 | Uniprot |
P30307 (CDC25C) | S207 | Uniprot |
P35222 (CTNNB1) | S605 | Uniprot |
P53778-1 (MAPK12) | S3 | Uniprot |
P78352 (DLG4) | T287 | Uniprot |
P78352 (DLG4) | S290 | Uniprot |
Q12959 (DLG1) | S122 | Uniprot |
Q12959 (DLG1) | S158 | Uniprot |
Q12959 (DLG1) | T209 | Uniprot |
Q12959 (DLG1) | S443 | Uniprot |
Q12959 (DLG1) | Y447 | Uniprot |
Q13424-1 (SNTA1) | S193 | Uniprot |
Q13424 (SNTA1) | S201 | Uniprot |
Q14934 (NFATC4) | S168 | Uniprot |
Q14934 (NFATC4) | S170 | Uniprot |
Q8IW41 (MAPKAPK5) | T182 | Uniprot |
Research Backgrounds
Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK12 is one of the four p38 MAPKs which play an important role in the cascades of cellular responses evoked by extracellular stimuli such as proinflammatory cytokines or physical stress leading to direct activation of transcription factors such as ELK1 and ATF2. Accordingly, p38 MAPKs phosphorylate a broad range of proteins and it has been estimated that they may have approximately 200 to 300 substrates each. Some of the targets are downstream kinases such as MAPKAPK2, which are activated through phosphorylation and further phosphorylate additional targets. Plays a role in myoblast differentiation and also in the down-regulation of cyclin D1 in response to hypoxia in adrenal cells suggesting MAPK12 may inhibit cell proliferation while promoting differentiation. Phosphorylates DLG1. Following osmotic shock, MAPK12 in the cell nucleus increases its association with nuclear DLG1, thereby causing dissociation of DLG1-SFPQ complexes. This function is independent of its catalytic activity and could affect mRNA processing and/or gene transcription to aid cell adaptation to osmolarity changes in the environment. Regulates UV-induced checkpoint signaling and repair of UV-induced DNA damage and G2 arrest after gamma-radiation exposure. MAPK12 is involved in the regulation of SLC2A1 expression and basal glucose uptake in L6 myotubes; and negatively regulates SLC2A4 expression and contraction-mediated glucose uptake in adult skeletal muscle. C-Jun (JUN) phosphorylation is stimulated by MAPK14 and inhibited by MAPK12, leading to a distinct AP-1 regulation. MAPK12 is required for the normal kinetochore localization of PLK1, prevents chromosomal instability and supports mitotic cell viability. MAPK12-signaling is also positively regulating the expansion of transient amplifying myogenic precursor cells during muscle growth and regeneration.
Dually phosphorylated on Thr-183 and Tyr-185 by MAP2K3/MKK3 and MAP2K6/MKK6, which activates the enzyme.
Ubiquitinated. Ubiquitination leads to degradation by the proteasome pathway.
Cytoplasm. Nucleus. Mitochondrion.
Note: Mitochondrial when associated with SH3BP5. In skeletal muscle colocalizes with SNTA1 at the neuromuscular junction and throughout the sarcolemma (By similarity).
Highly expressed in skeletal muscle and heart.
Monomer. Interacts with the PDZ domain of the syntrophin SNTA1. Interacts with SH3BP5. Interacts with LIN7C, SCRIB and SYNJ2BP (By similarity). Interacts with PTPN4; this interaction induces the activation of PTPN4 phosphatase activity.
The TXY motif contains the threonine and tyrosine residues whose phosphorylation activates the MAP kinases.
Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
Research Fields
· Cellular Processes > Cell growth and death > Oocyte meiosis. (View pathway)
· Cellular Processes > Cell growth and death > Cellular senescence. (View pathway)
· Cellular Processes > Cellular community - eukaryotes > Signaling pathways regulating pluripotency of stem cells. (View pathway)
· Environmental Information Processing > Signal transduction > MAPK signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Rap1 signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > FoxO signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Sphingolipid signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > TNF signaling pathway. (View pathway)
· Human Diseases > Drug resistance: Antineoplastic > Endocrine resistance.
· Human Diseases > Neurodegenerative diseases > Amyotrophic lateral sclerosis (ALS).
· Human Diseases > Infectious diseases: Bacterial > Epithelial cell signaling in Helicobacter pylori infection.
· Human Diseases > Infectious diseases: Bacterial > Shigellosis.
· Human Diseases > Infectious diseases: Bacterial > Salmonella infection.
· Human Diseases > Infectious diseases: Bacterial > Pertussis.
· Human Diseases > Infectious diseases: Parasitic > Leishmaniasis.
· Human Diseases > Infectious diseases: Parasitic > Chagas disease (American trypanosomiasis).
· Human Diseases > Infectious diseases: Parasitic > Toxoplasmosis.
· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.
· Human Diseases > Infectious diseases: Viral > Hepatitis C.
· Human Diseases > Infectious diseases: Viral > Influenza A.
· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.
· Human Diseases > Cancers: Overview > Proteoglycans in cancer.
· Organismal Systems > Circulatory system > Adrenergic signaling in cardiomyocytes. (View pathway)
· Organismal Systems > Development > Osteoclast differentiation. (View pathway)
· Organismal Systems > Immune system > Platelet activation. (View pathway)
· Organismal Systems > Immune system > Toll-like receptor signaling pathway. (View pathway)
· Organismal Systems > Immune system > NOD-like receptor signaling pathway. (View pathway)
· Organismal Systems > Immune system > RIG-I-like receptor signaling pathway. (View pathway)
· Organismal Systems > Immune system > IL-17 signaling pathway. (View pathway)
· Organismal Systems > Immune system > Th1 and Th2 cell differentiation. (View pathway)
· Organismal Systems > Immune system > Th17 cell differentiation. (View pathway)
· Organismal Systems > Immune system > T cell receptor signaling pathway. (View pathway)
· Organismal Systems > Immune system > Fc epsilon RI signaling pathway. (View pathway)
· Organismal Systems > Immune system > Leukocyte transendothelial migration. (View pathway)
· Organismal Systems > Nervous system > Neurotrophin signaling pathway. (View pathway)
· Organismal Systems > Nervous system > Retrograde endocannabinoid signaling. (View pathway)
· Organismal Systems > Nervous system > Dopaminergic synapse.
· Organismal Systems > Sensory system > Inflammatory mediator regulation of TRP channels. (View pathway)
· Organismal Systems > Endocrine system > Progesterone-mediated oocyte maturation.
· Organismal Systems > Endocrine system > Prolactin signaling pathway. (View pathway)
· Organismal Systems > Endocrine system > Relaxin signaling pathway.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.