PDHA2 Antibody - #DF2228
Product: | PDHA2 Antibody |
Catalog: | DF2228 |
Description: | Rabbit polyclonal antibody to PDHA2 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Bovine, Horse, Sheep, Rabbit |
Mol.Wt.: | 43 kDa; 43kD(Calculated). |
Uniprot: | P29803 |
RRID: | AB_2839459 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2228, RRID:AB_2839459.
Fold/Unfold
EC 1.2.4.1; MGC149517; MGC149518; mitochondrial; ODPAT_HUMAN; Pdha2; PDHAL; PDHE1 A type II; PDHE1-A type II; Pyruvate dehydrogenase (lipoamide) alpha 2; Pyruvate dehydrogenase E1 component subunit alpha; Pyruvate dehydrogenase E1 component subunit alpha, testis specific form, mitochondrial; Pyruvate dehydrogenase, E1 alpha polypeptide, testis spec; testis-specific form;
Immunogens
- P29803 ODPAT_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLAAFISRVLRRVAQKSARRVLVASRNSSNDATFEIKKCDLYLLEEGPPVTTVLTRAEGLKYYRMMLTVRRMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHGVCYTRGLSVRSILAELTGRRGGCAKGKGGSMHMYTKNFYGGNGIVGAQGPLGAGIALACKYKGNDEICLTLYGDGAANQGQIAEAFNMAALWKLPCVFICENNLYGMGTSTERAAASPDYYKRGNFIPGLKVDGMDVLCVREATKFAANYCRSGKGPILMELQTYRYHGHSMSDPGVSYRTREEIQEVRSKRDPIIILQDRMVNSKLATVEELKEIGAEVRKEIDDAAQFATTDPEPHLEELGHHIYSSDSSFEVRGANPWIKFKSVS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P29803 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K16 | Sumoylation | Uniprot | |
K37 | Acetylation | Uniprot | |
Y42 | Phosphorylation | Uniprot | |
Y62 | Phosphorylation | Uniprot | |
Y63 | Phosphorylation | Uniprot | |
K75 | Acetylation | Uniprot | |
K81 | Acetylation | Uniprot | |
K81 | Ubiquitination | Uniprot | |
S150 | Phosphorylation | Uniprot | |
Y154 | Phosphorylation | Uniprot | |
S230 | Phosphorylation | Q15118 (PDK1) | Uniprot |
K275 | Acetylation | Uniprot | |
Y287 | Phosphorylation | Uniprot | |
S291 | Phosphorylation | Q15120 (PDK3) , Q15119 (PDK2) , Q15118 (PDK1) , Q16654 (PDK4) | Uniprot |
S293 | Phosphorylation | Uniprot | |
S298 | Phosphorylation | Q16654 (PDK4) , Q15119 (PDK2) , Q15120 (PDK3) , Q15118 (PDK1) | Uniprot |
Y299 | Phosphorylation | Uniprot | |
T301 | Phosphorylation | Uniprot |
Research Backgrounds
The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2), and thereby links the glycolytic pathway to the tricarboxylic cycle.
Phosphorylation at Ser-291, Ser-293 and Ser-298 by PDK family kinases inactivates the enzyme; for this phosphorylation at a single site is sufficient. Phosphorylation at Ser-293 interferes with access to active site, and thereby inactivates the enzyme. Dephosphorylation at all three sites, i.e. at Ser-291, Ser-293 and Ser-298, is required for reactivation.
Mitochondrion matrix.
Testis. Expressed in postmeiotic spermatogenic cells.
Heterotetramer of two PDHA2 and two PDHB subunits. The heterotetramer interacts with DLAT, and is part of the multimeric pyruvate dehydrogenase complex that contains multiple copies of pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (DLAT, E2) and lipoamide dehydrogenase (DLD, E3). These subunits are bound to an inner core composed of about 48 DLAT and 12 PDHX molecules.
Research Fields
· Environmental Information Processing > Signal transduction > HIF-1 signaling pathway. (View pathway)
· Human Diseases > Cancers: Overview > Central carbon metabolism in cancer. (View pathway)
· Metabolism > Carbohydrate metabolism > Glycolysis / Gluconeogenesis.
· Metabolism > Carbohydrate metabolism > Citrate cycle (TCA cycle).
· Metabolism > Carbohydrate metabolism > Pyruvate metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
· Metabolism > Global and overview maps > Carbon metabolism.
· Organismal Systems > Endocrine system > Glucagon signaling pathway.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.