TCEB2 Antibody - #DF7302
Product: | TCEB2 Antibody |
Catalog: | DF7302 |
Description: | Rabbit polyclonal antibody to TCEB2 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Sheep, Xenopus |
Mol.Wt.: | 13kDa; 13kD(Calculated). |
Uniprot: | Q15370 |
RRID: | AB_2839240 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7302, RRID:AB_2839240.
Fold/Unfold
EloB; ELOB_HUMAN; Elongin 18 kDa subunit; Elongin B; Elongin-B; RNA polymerase II transcription factor SIII p18 subunit; RNA polymerase II transcription factor SIII subunit B; SIII; SIII p18; TCEB 2; Tceb2; Transcription elongation factor B (SIII) polypeptide 2; Transcription elongation factor B polypeptide 2;
Immunogens
- Q15370 ELOB_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q15370 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
M1 | Acetylation | Uniprot | |
K11 | Acetylation | Uniprot | |
T13 | Phosphorylation | Uniprot | |
T16 | Phosphorylation | Uniprot | |
K19 | Ubiquitination | Uniprot | |
K28 | Ubiquitination | Uniprot | |
K36 | Ubiquitination | Uniprot | |
R43 | Methylation | Uniprot | |
K46 | Ubiquitination | Uniprot | |
K55 | Ubiquitination | Uniprot | |
T74 | Phosphorylation | Uniprot | |
T84 | Phosphorylation | Uniprot | |
K104 | Ubiquitination | Uniprot |
Research Backgrounds
SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex). In embryonic stem cells, the elongin BC complex is recruited by EPOP to Polycomb group (PcG) target genes in order generate genomic region that display both active and repressive chromatin properties, an important feature of pluripotent stem cells (By similarity).
The elongin BC complex seems to be involved as an adapter protein in the proteasomal degradation of target proteins via different E3 ubiquitin ligase complexes, including the von Hippel-Lindau ubiquitination complex CBC(VHL). By binding to BC-box motifs it seems to link target recruitment subunits, like VHL and members of the SOCS box family, to Cullin/RBX1 modules that activate E2 ubiquitination enzymes.
Nucleus.
Heterotrimer of an A (ELOA, ELOA2 or ELOA3), ELOB and ELOC subunit. The elongin BC complex interacts with EPOP; leading to recruit the elongin BC complex to Polycomb group (PcG) target genes, thereby restricting excessive activity of the PRC2/EED-EZH2 complex (By similarity). Part of E3 ubiquitin ligase complexes with CUL5 or CUL2, RBX1 and a substrate adapter protein that can be either SOCS1, SOCS5, ELOA, VHL or WSB1. Interacts with VHL. Found in a complex composed of LIMD1, VHL, EGLN1/PHD2, ELOB and CUL2. Interacts with SPSB1. Interacts with KLHDC10; which may be an E3 ubiquitin ligase complex substrate recognition component.
(Microbial infection) Substrate adapter protein can be a viral protein such as HIV Vif.
(Microbial infection) Interacts with molluscum contagiosum virus MC132.
(Microbial infection) Interacts with herpes virus 8 virus protein LANA1.
Research Fields
· Environmental Information Processing > Signal transduction > HIF-1 signaling pathway. (View pathway)
· Genetic Information Processing > Folding, sorting and degradation > Ubiquitin mediated proteolysis. (View pathway)
· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)
· Human Diseases > Cancers: Specific types > Renal cell carcinoma. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.