14-3-3 theta Antibody - #DF7016

Product: | 14-3-3 theta Antibody |
Catalog: | DF7016 |
Description: | Rabbit polyclonal antibody to 14-3-3 theta |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Chicken, Xenopus |
Mol.Wt.: | 28kDa; 28kD(Calculated). |
Uniprot: | P27348 |
RRID: | AB_2838972 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7016, RRID:AB_2838972.
Fold/Unfold
14 3 3 protein T cell; 14 3 3 protein tau; 14 3 3 protein theta; 14 3 3 tau; 14 3 3 theta; 14-3-3 protein T-cell; 14-3-3 protein tau; 14-3-3 protein theta; 1433T_HUMAN; 1C5; HS1; KCIP1; Protein HS1; Protein kinase C inhibitor protein 1; Protein tau; tyr3/trp5 monooxygenase activation protein, theta; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, theta polypeptide; Ywhaq;
Immunogens
Abundantly expressed in brain, heart and pancreas, and at lower levels in kidney and placenta. Up-regulated in the lumbar spinal cord from patients with sporadic amyotrophic lateral sclerosis (ALS) compared with controls, with highest levels of expression in individuals with predominant lower motor neuron involvement.
- P27348 1433T_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P27348 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
M1 | Acetylation | Uniprot | |
K3 | Acetylation | Uniprot | |
K3 | Ubiquitination | Uniprot | |
K9 | Acetylation | Uniprot | |
K9 | Ubiquitination | Uniprot | |
K11 | Acetylation | Uniprot | |
K11 | Ubiquitination | Uniprot | |
Y19 | Phosphorylation | Uniprot | |
T24 | Phosphorylation | Uniprot | |
C25 | S-Nitrosylation | Uniprot | |
K27 | Acetylation | Uniprot | |
K27 | Ubiquitination | Uniprot | |
S37 | Phosphorylation | Uniprot | |
S45 | Phosphorylation | Uniprot | |
Y48 | Phosphorylation | Uniprot | |
K49 | Acetylation | Uniprot | |
K49 | Ubiquitination | Uniprot | |
S57 | Phosphorylation | Uniprot | |
S64 | Phosphorylation | Uniprot | |
K68 | Acetylation | Uniprot | |
K68 | Ubiquitination | Uniprot | |
K74 | Ubiquitination | Uniprot | |
K75 | Ubiquitination | Uniprot | |
K80 | Acetylation | Uniprot | |
K80 | Ubiquitination | Uniprot | |
Y82 | Phosphorylation | Uniprot | |
K85 | Acetylation | Uniprot | |
K85 | Ubiquitination | Uniprot | |
S88 | Phosphorylation | Uniprot | |
S92 | Phosphorylation | Uniprot | |
C94 | S-Nitrosylation | Uniprot | |
T95 | Phosphorylation | Uniprot | |
K103 | Ubiquitination | Uniprot | |
T110 | Phosphorylation | Uniprot | |
S114 | Phosphorylation | Uniprot | |
K115 | Acetylation | Uniprot | |
K115 | Ubiquitination | Uniprot | |
K120 | Acetylation | Uniprot | |
K120 | Ubiquitination | Uniprot | |
K122 | Ubiquitination | Uniprot | |
Y125 | Phosphorylation | Uniprot | |
Y128 | Phosphorylation | Uniprot | |
C134 | S-Nitrosylation | Uniprot | |
K139 | Acetylation | Uniprot | |
K139 | Ubiquitination | Uniprot | |
T141 | Phosphorylation | Uniprot | |
S145 | Phosphorylation | Uniprot | |
Y149 | Phosphorylation | Uniprot | |
S156 | Phosphorylation | Uniprot | |
K157 | Acetylation | Uniprot | |
K157 | Ubiquitination | Uniprot | |
K158 | Acetylation | Uniprot | |
K158 | Ubiquitination | Uniprot | |
K193 | Ubiquitination | Uniprot | |
T205 | Phosphorylation | Uniprot | |
S210 | Phosphorylation | Uniprot | |
Y211 | Phosphorylation | Uniprot | |
K212 | Methylation | Uniprot | |
S214 | Phosphorylation | Uniprot | |
T215 | Phosphorylation | Uniprot | |
T229 | Phosphorylation | Uniprot | |
S230 | Phosphorylation | Uniprot | |
S232 | Phosphorylation | P11274 (BCR) , P48729 (CSNK1A1) | Uniprot |
Research Backgrounds
Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negatively regulates the kinase activity of PDPK1.
Ser-232 is probably phosphorylated by CK1.
Cytoplasm.
Note: In neurons, axonally transported to the nerve terminals.
Abundantly expressed in brain, heart and pancreas, and at lower levels in kidney and placenta. Up-regulated in the lumbar spinal cord from patients with sporadic amyotrophic lateral sclerosis (ALS) compared with controls, with highest levels of expression in individuals with predominant lower motor neuron involvement.
Homodimer. Interacts with CDK16 (By similarity). Interacts with RGS7 (phosphorylated form). Interacts with SSH1. Interacts with CDKN1B ('Thr-198' phosphorylated form); the interaction translocates CDKN1B to the cytoplasm. Interacts with GAB2. Interacts with the 'Ser-241' phosphorylated form of PDPK1. Interacts with the 'Thr-369' phosphorylated form of DAPK2. Interacts with PI4KB, TBC1D22A and TBC1D22B. Interacts with SLITRK1. Interacts with RIPOR2 isoform 2. Interacts with INAVA; the interaction increases upon PRR (pattern recognition receptor) stimulation and is required for cellular signaling pathway activation and cytokine secretion. Interacts with MARK2, MARK3 and MARK4.
Belongs to the 14-3-3 family.
Research Fields
· Cellular Processes > Cell growth and death > Cell cycle. (View pathway)
· Cellular Processes > Cell growth and death > Oocyte meiosis. (View pathway)
· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Hippo signaling pathway. (View pathway)
· Human Diseases > Infectious diseases: Bacterial > Pathogenic Escherichia coli infection.
· Human Diseases > Infectious diseases: Viral > Hepatitis B.
· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.
· Human Diseases > Cancers: Overview > Viral carcinogenesis.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.