NPPA Antibody - #DF6497
Product: | NPPA Antibody |
Catalog: | DF6497 |
Description: | Rabbit polyclonal antibody to NPPA |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus |
Mol.Wt.: | 17kDa; 16kD(Calculated). |
Uniprot: | P01160 |
RRID: | AB_2838459 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6497, RRID:AB_2838459.
Fold/Unfold
ANF; ANF_HUMAN; ANP; ATFB6; Atrial natriuretic factor; Atrial natriuretic peptide; Atriopeptin; Cardiodilatin; Cardiodilatin-related peptide; Cardionatrin; CDD ANF; CDD; CDD-ANF; CDP; Natriuretic peptide A; Natriuretic peptide precursor A; NPPA; PND; Prepronatriodilatin; ANP;
Immunogens
- P01160 ANF_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSSFSTTTVSFLLLLAFQLLGQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P01160 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K41 | Acetylation | Uniprot | |
Y151 | Phosphorylation | Uniprot |
Research Backgrounds
Hormone playing a key role in cardiovascular homeostasis through regulation of natriuresis, diuresis, and vasodilation. Also plays a role in female pregnancy by promoting trophoblast invasion and spiral artery remodeling in uterus. Specifically binds and stimulates the cGMP production of the NPR1 receptor. Binds the clearance receptor NPR3.
Cleaved by CORIN upon secretion to produce the functional hormone.
Atrial natriuretic factor: Cleaved by MME. The cleavage initiates degradation of the factor and thereby regulate its activity.
Secreted.
Belongs to the natriuretic peptide family.
Research Fields
· Environmental Information Processing > Signal transduction > HIF-1 signaling pathway. (View pathway)
References
Application: WB Species: Rat Sample: H9c2 cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.