IL6R Antibody | Affinity Biosciences

IHC
Cites

1/4

DF6466 at 1/100 staining Human pancreatic cancer and adjacent nomal tissues by IHC-P.

DF6466 at 1/100 staining Human kidney cancer by IHC-P.

Fig.

Figure 2.

Product:	IL6R Antibody
Catalog:	DF6466
Description:	Rabbit polyclonal antibody to IL6R
Application:	WB IHC
Reactivity:	Human, Mouse
Mol.Wt.:	52kD; 52kD(Calculated).
Uniprot:	P08887
RRID:	AB_2838428

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
100ul	$280	In stock
200ul	$350	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MS Report

HPLC Report

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human,Mouse

Clonality:

Polyclonal

Specificity:

IL6R Antibody detects endogenous levels of total IL6R.

RRID:

AB_2838428
Cite Format: Affinity Biosciences Cat# DF6466, RRID:AB_2838428.

Conjugate:

Unconjugated.

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

CD 126; CD126; CD126 antigen; gp80; IL 6R 1; IL 6R alpha; IL 6R; IL-6 receptor alpha chain; IL-6 receptor subunit alpha; IL-6R 1; IL-6R subunit alpha; IL-6R-alpha; IL-6RA; IL6Q; Il6r; IL6RA; IL6RA_HUMAN; IL6RQ; Interleukin 6 receptor; interleukin 6 receptor, alpha; Interleukin-6 receptor subunit alpha; Membrane glycoprotein 80; MGC30256;

Immunogens

Immunogen:

Uniprot:

P08887(IL6RA_HUMAN) >>Visit HPA database.

Gene(ID):

IL6R(3570)

Expression:

P08887 IL6RA_HUMAN:

Isoform 2 is expressed in peripheral blood mononuclear cells and weakly found in urine and serum.

Description:

Interleukin-6 (IL-6) is a pleiotropic cytokine produced by a variety of cells during infection, trauma, and immunological challenge (PMID: 8274730). IL-6 acts via a receptor complex consisting of two distinct membrane-bound glycoproteins, an 80-kDa IL-6-binding subunit (IL-6R, CD126, gp80) and a 130-kDa signal-transducing element (gp130, CD130). After binding of IL-6 to membrane-bound IL-6R, the complex of IL-6 and IL-6R associates with gp130, thus activating the receptor (PMID: 9716487). Expression of gp130 is found in almost all organs while expression of IL-6R is predominantly confined to hepatocytes and leukocyte subpopulations (monocytes, neutrophils, T cells, and B cells) (PMID: 11149892). Soluble form of IL-6R has been found in human serum and urine.

Sequence:

P08887 IL6RA_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR

PTMs - P08887 As Substrate

P08887

Site	PTM Type	Source
N55	N-Glycosylation	Uniprot
S91	Phosphorylation	Uniprot
N93	N-Glycosylation	Uniprot
T139	Phosphorylation	Uniprot
S141	Phosphorylation	Uniprot
T144	Phosphorylation	Uniprot
N221	N-Glycosylation	Uniprot
S243	Phosphorylation	Uniprot
S455	Phosphorylation	Uniprot
Y457	Phosphorylation	Uniprot
Y464	Phosphorylation	Uniprot

Research Backgrounds

P08887_IL6RA_HUMAN

Function:

Part of the receptor for interleukin 6. Binds to IL6 with low affinity, but does not transduce a signal. Signal activation necessitate an association with IL6ST. Activation may lead to the regulation of the immune response, acute-phase reactions and hematopoiesis.

Low concentration of a soluble form of IL6 receptor acts as an agonist of IL6 activity.

PTMs:

A short soluble form may also be released from the membrane by proteolysis.

Subcellular Location:

Basolateral cell membrane>Single-pass type I membrane protein.

Secreted.

Tissue Specificity:

Isoform 2 is expressed in peripheral blood mononuclear cells and weakly found in urine and serum.

Subunit Structure:

Hexamer of two molecules each of IL6, IL6R and IL6ST. Interacts (via N-terminal ectodomain) with SORL1; this interaction may affect IL6-binding to IL6R, hence decrease IL6 cis-signaling. The soluble form of IL6R also interacts with SORL1; this interaction leads to soluble IL6R internalization. May form a trimeric complex with the soluble SORL1 ectodomain and circulating IL6 receptor; this interaction might stabilize circulating IL6, hence promote IL6 trans signaling.

Family&Domains:

The two fibronectin type-III-like domains, contained in the N-terminal part, form together a cytokine-binding domain.

The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.

Belongs to the type I cytokine receptor family. Type 3 subfamily.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)

· Environmental Information Processing > Signal transduction > HIF-1 signaling pathway. (View pathway)

· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway. (View pathway)

· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway. (View pathway)

· Human Diseases > Drug resistance: Antineoplastic > EGFR tyrosine kinase inhibitor resistance.

· Human Diseases > Endocrine and metabolic diseases > Non-alcoholic fatty liver disease (NAFLD).

· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)

· Organismal Systems > Immune system > Hematopoietic cell lineage. (View pathway)

· Organismal Systems > Immune system > Th17 cell differentiation. (View pathway)

References

1). Macrophage Membrane-Derived Biomimetic Nanoparticles for Treatment of Cytokine Release Syndrome. Journal of Biomedical Nanotechnology, 2022 (PubMed: 35854441) [IF=2.9]

2). Antinociceptive effects of IL-6R vs. glucocorticoid receptors during rat hind paw inflammatory pain. NEUROSCIENCE LETTERS, 2020 (PubMed: 32898615) [IF=2.5]

Application: WB Species: rat Sample: spinal cord

Fig. 4. |IL-6-induced signaling pathway test was assessed in the spinal cord by Western blotting, and the IL-6 and sIL-6R concentration levels in the serum and CSF were tested by ELISA. A–H: Levels of IL-6, IL-6Rα, gp130, JAK2, pJAK2, STAT3, and pSTAT3 proteins in the spinal cord following three consecutive days of i.th. injection of anti-IL-6R (20 μg/d), sgp130 (20 μg/d), and Dexamethasone (20 μg/d).

3). Therapeutic Effect of Macrophage-Derived Biomimetic Nanoparticles for Cytokine Release Syndrome. , 2021

Application: WB Species: Mouse Sample:

Figure 2. Characterization of biomimetic nanoparticles. (A) The particle size and zeta potential of PLGA nanoparticles and PNP@MP were detected by DLS; (B) Particle size distribution range of PLGA and PNP@MP; (C) Transmission electron microscope image of PNP@MP negatively stained with phosphotungstic acid; (D) Stability of PNP@MP in PBS or PBS containing 10% FBS within 72 h;(E) Characteristic protein bands of macrophage cell lysates, membrane-derived biomimetic nanoparticles resolved by Western blotting.

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

IL6R Antibody - #DF6466