Product: CD32 Antibody
Catalog: DF6402
Description: Rabbit polyclonal antibody to CD32
Application: WB IHC IF/ICC
Reactivity: Human
Mol.Wt.: 35kDa; 35kD(Calculated).
Uniprot: P12318
RRID: AB_2838365

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Polyclonal
Specificity:
CD32 Antibody detects endogenous levels of total CD32.
RRID:
AB_2838365
Cite Format: Affinity Biosciences Cat# DF6402, RRID:AB_2838365.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CD32; CD32 antigen; CDw32; Fc fragment of IgG, low affinity IIa, receptor (CD32); Fc fragment of IgG, low affinity IIa, receptor for (CD32); Fc gamma RII a; Fc gamma RIIa; Fc-gamma RII-a; Fc-gamma-RIIa; FCG2; FCG2A_HUMAN; FcGR; FCGR2; FCGR2A; FCGR2A1; FcRII a; FcRII-a; IGFR2; IgG Fc receptor II a; IgG Fc receptor II-a; Immunoglobulin G Fc receptor II; low affinity immunoglobulin gamma Fc region receptor II a; Low affinity immunoglobulin gamma Fc region receptor II-a;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P12318 FCG2A_HUMAN:

Found on monocytes, neutrophils and eosinophil platelets.

Description:
CD32 (also designated Fc gamma RII) is a low affinity receptor for the Fc fragment of aggregated IgG (1,2). CD32 is responsible for the clearance of immunocomplexes by macrophages and also plays an important role in the regulation of antibody production by B cells (1-4). IgG can noncooperatively bind either one or two highly glycosylated CD32 molecules, and this binding delivers.3 a negative signal for B cells (1,2,5). CD32 exists as several isoforms that are produced by alternative splicing of three distinct genes, A, B, and C (2,6). These isoforms are designated FcgRIIA, FcgRIIB1, FcgRIIB3, and FcgRIIC (1,2,6). All isoforms are present on monocytes, placental trophoblasts and endothelial cells (1,6). In addition, the FcgRIIB forms are present on B lymphocytes, and the FcgRIIA and FcgRIIC forms are found on neutrophils (1,6).
Sequence:
MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIIVAVVIATAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN

PTMs - P12318 As Substrate

Site PTM Type Enzyme
N97 N-Glycosylation
N178 N-Glycosylation
Y240 Phosphorylation
K255 Ubiquitination
K271 Acetylation
T277 Phosphorylation
Y281 Phosphorylation P51451 (BLK) , P43405 (SYK) , P07948 (LYN) , P06241 (FYN)
T283 Phosphorylation
Y288 Phosphorylation P07948 (LYN) , P43405 (SYK) , P51451 (BLK) , P06241 (FYN)
T290 Phosphorylation
T297 Phosphorylation
Y304 Phosphorylation P43405 (SYK) , P06241 (FYN) , P07948 (LYN) , P51451 (BLK)

Research Backgrounds

Function:

Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized antigens.

PTMs:

Phosphorylated by SRC-type Tyr-kinases such as LYN, BLK, FYN, HCK and SYK.

Subcellular Location:

Cell membrane>Single-pass type I membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Found on monocytes, neutrophils and eosinophil platelets.

Subunit Structure:

Interacts with INPP5D/SHIP1 and INPPL1/SHIP2, regulating its function. Interacts with APCS and FGR. Interacts with HCK.

Research Fields

· Cellular Processes > Transport and catabolism > Phagosome.   (View pathway)

· Human Diseases > Infectious diseases: Parasitic > Leishmaniasis.

· Human Diseases > Infectious diseases: Bacterial > Staphylococcus aureus infection.

· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.

· Human Diseases > Immune diseases > Systemic lupus erythematosus.

· Organismal Systems > Development > Osteoclast differentiation.   (View pathway)

· Organismal Systems > Immune system > Platelet activation.   (View pathway)

· Organismal Systems > Immune system > Fc gamma R-mediated phagocytosis.   (View pathway)

References

1). Loganin alleviates macrophage infiltration and activation by inhibiting the MCP-1/CCR2 axis in diabetic nephropathy. LIFE SCIENCES, 2021 (PubMed: 33245967) [IF=6.1]

Application: WB    Species: mice    Sample: RAW264.7 cells

Fig. 4 Effect of loganin on phenotypic transformation of macrophages. (A) The expressions of iNOS and CD16/32 in RAW264.7 cells were quantified. (B) The expressions of Arg-1 and CD206 in RAW264.7 cells were quantified. (C) The expression of iNOS in the kidney of DN mice was quantified. (D) The expression of CD206 in the kidney of DN mice was quantified. Representative results were obtained from at least three independent experiments. Data were expressed as mean ± SD. #P<0.05 and ##P<0.01 versus the normal group or the control group, *P<0.05 and **P<0.01 versus the model group or the AGEs group. The experiment was repeated three times.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.