CD3D Antibody - #DF6370
Product: | CD3D Antibody |
Catalog: | DF6370 |
Description: | Rabbit polyclonal antibody to CD3D |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Bovine, Horse, Sheep |
Mol.Wt.: | 19kDa; 19kD(Calculated). |
Uniprot: | P04234 |
RRID: | AB_2838334 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6370, RRID:AB_2838334.
Fold/Unfold
CD3 antigen delta subunit; CD3 delta; CD3d; CD3d antigen delta polypeptide (TiT3 complex); CD3d molecule delta (CD3-TCR complex); CD3D_HUMAN; IMD19; OKT3 delta chain; T cell receptor T3 delta chain; T-cell receptor T3 delta chain; T-cell surface glycoprotein CD3 delta chain; T3D;
Immunogens
CD3D is mostly present on T-lymphocytes with its TCR-CD3 partners. Present also in fetal NK-cells.
- P04234 CD3D_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P04234 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K62 | Ubiquitination | Uniprot | |
K80 | Ubiquitination | Uniprot | |
K82 | Ubiquitination | Uniprot | |
T139 | Phosphorylation | Uniprot | |
Y149 | Phosphorylation | Uniprot | |
Y160 | Phosphorylation | Uniprot | |
S161 | Phosphorylation | Uniprot |
Research Backgrounds
Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition of this role of signal transduction in T-cell activation, CD3D plays an essential role in thymocyte differentiation. Indeed, participates in correct intracellular TCR-CD3 complex assembly and surface expression. In absence of a functional TCR-CD3 complex, thymocytes are unable to differentiate properly. Interacts with CD4 and CD8 and thus serves to establish a functional link between the TCR and coreceptors CD4 and CD8, which is needed for activation and positive selection of CD4 or CD8 T-cells.
Phosphorylated on Tyr residues after T-cell receptor triggering by LCK in association with CD4/CD8.
Cell membrane>Single-pass type I membrane protein.
CD3D is mostly present on T-lymphocytes with its TCR-CD3 partners. Present also in fetal NK-cells.
The TCR-CD3 complex is composed of a CD3D/CD3E and a CD3G/CD3E heterodimers that preferentially associate with TCRalpha and TCRbeta, respectively, to form TCRalpha/CD3E/CD3G and TCRbeta/CD3G/CD3E trimers. In turn, the hexamer interacts with CD3Z homodimer to form the TCR-CD3 complex. Alternatively, TCRalpha and TCRbeta can be replaced by TCRgamma and TCRdelta. Interacts with coreceptors CD4 and CD8.
Research Fields
· Human Diseases > Infectious diseases: Parasitic > Chagas disease (American trypanosomiasis).
· Human Diseases > Infectious diseases: Viral > Measles.
· Human Diseases > Infectious diseases: Viral > HTLV-I infection.
· Human Diseases > Immune diseases > Primary immunodeficiency.
· Organismal Systems > Immune system > Hematopoietic cell lineage. (View pathway)
· Organismal Systems > Immune system > Th1 and Th2 cell differentiation. (View pathway)
· Organismal Systems > Immune system > Th17 cell differentiation. (View pathway)
· Organismal Systems > Immune system > T cell receptor signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.