LDHA Antibody - #DF6280
(18)
(17)
Related Downloads
Protocols
Product Info
Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Reactivity:
Human,Mouse,Rat
Prediction:
Pig(89%), Bovine(89%), Sheep(89%), Rabbit(89%), Dog(89%)
Clonality:
Polyclonal
Specificity:
LDHA Antibody detects endogenous levels of total LDHA.
RRID:
AB_2838246
Cite Format: Affinity Biosciences Cat# DF6280, RRID:AB_2838246.
Cite Format: Affinity Biosciences Cat# DF6280, RRID:AB_2838246.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:
Fold/Unfold
Cell proliferation-inducing gene 19 protein; L lactate dehydrogenase A chain; Lactate dehydrogenase A; LDH A; LDH M; LDH muscle subunit; LDH1; LDH5; LDHA; PIG 19; PIG19; Renal carcinoma antigen NY-REN-59;
Immunogens
Immunogen:
Uniprot:
Gene(ID):
Description:
Lactate dehydrogenase (LDH) catalyzes the interconversion of pyruvate and NADH to lactate and NAD+. When the oxygen supply is too low for mitochondrial ATP production, this reaction recycles NADH generated in glycolysis to NAD+, which reenters glycolysis. The major form of LDH found in muscle cells is the A (LDHA) isozyme. The LDHA promoter contains HIF-1α binding sites (1). LDHA expression is induced under hypoxic conditions (2). During intensive and prolonged muscle exercise, lactate accumulates in muscle cells when the supply of oxygen does not meet demand. When oxygen levels return to normal, LDH converts lactate to pyruvate to generate ATP in the mitochondrial electron transport chain.
Sequence:
- P00338 LDHA_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Predictions
Predictions:
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
Species
Results
Score
Pig
89
Bovine
89
Sheep
89
Dog
89
Rabbit
89
Horse
0
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P00338 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| A2 | Acetylation | Uniprot | |
| T3 | Phosphorylation | Uniprot | |
| K5 | Acetylation | Uniprot | |
| K5 | Methylation | Uniprot | |
| K5 | Ubiquitination | Uniprot | |
| Y10 | Phosphorylation | P11362 (FGFR1) , P04626 (ERBB2) , P12931 (SRC) | Uniprot |
| K14 | Acetylation | Uniprot | |
| K14 | Sumoylation | Uniprot | |
| K14 | Ubiquitination | Uniprot | |
| T18 | Phosphorylation | Uniprot | |
| K22 | Acetylation | Uniprot | |
| K57 | Acetylation | Uniprot | |
| K57 | Ubiquitination | Uniprot | |
| K59 | Ubiquitination | Uniprot | |
| T74 | Phosphorylation | Uniprot | |
| K76 | Ubiquitination | Uniprot | |
| K81 | Acetylation | Uniprot | |
| K81 | Ubiquitination | Uniprot | |
| Y83 | Phosphorylation | P11362 (FGFR1) | Uniprot |
| S89 | Phosphorylation | Uniprot | |
| K90 | Ubiquitination | Uniprot | |
| T95 | Phosphorylation | Uniprot | |
| K118 | Acetylation | Uniprot | |
| K118 | Methylation | Uniprot | |
| K118 | Ubiquitination | Uniprot | |
| K126 | Acetylation | Uniprot | |
| K126 | Ubiquitination | Uniprot | |
| Y127 | Phosphorylation | Uniprot | |
| S128 | Phosphorylation | Uniprot | |
| K132 | Acetylation | Uniprot | |
| K132 | Ubiquitination | Uniprot | |
| Y145 | Phosphorylation | Uniprot | |
| K155 | Ubiquitination | Uniprot | |
| R157 | Methylation | Uniprot | |
| S161 | Phosphorylation | Uniprot | |
| S167 | Phosphorylation | Uniprot | |
| R169 | Methylation | Uniprot | |
| Y172 | Phosphorylation | Uniprot | |
| S184 | Phosphorylation | Uniprot | |
| K212 | Ubiquitination | Uniprot | |
| K222 | Acetylation | Uniprot | |
| K222 | Ubiquitination | Uniprot | |
| K224 | Acetylation | Uniprot | |
| K224 | Ubiquitination | Uniprot | |
| K228 | Acetylation | Uniprot | |
| K228 | Ubiquitination | Uniprot | |
| K232 | Acetylation | Uniprot | |
| K232 | Ubiquitination | Uniprot | |
| S237 | Phosphorylation | Uniprot | |
| Y239 | Phosphorylation | Uniprot | |
| K243 | Acetylation | Uniprot | |
| K243 | Ubiquitination | Uniprot | |
| K245 | Ubiquitination | Uniprot | |
| T248 | Phosphorylation | P06493 (CDK1) | Uniprot |
| S249 | Phosphorylation | Uniprot | |
| R269 | Methylation | Uniprot | |
| K278 | Acetylation | Uniprot | |
| K278 | Methylation | Uniprot | |
| K278 | Ubiquitination | Uniprot | |
| K284 | Ubiquitination | Uniprot | |
| K305 | Ubiquitination | Uniprot | |
| T309 | Phosphorylation | Uniprot | |
| S310 | Phosphorylation | Uniprot | |
| K317 | Ubiquitination | Uniprot | |
| K318 | Acetylation | Uniprot | |
| K318 | Ubiquitination | Uniprot | |
| S319 | Phosphorylation | Uniprot | |
| T322 | Phosphorylation | Uniprot | |
| K328 | Acetylation | Uniprot | |
| K328 | Sumoylation | Uniprot | |
| K328 | Ubiquitination | Uniprot |
Research Backgrounds
PTMs:
ISGylated.
Subcellular Location:
Cytoplasm.
Subunit Structure:
Homotetramer.
Family&Domains:
Belongs to the LDH/MDH superfamily. LDH family.
Research Fields
· Environmental Information Processing > Signal transduction > HIF-1 signaling pathway. (View pathway)
· Human Diseases > Cancers: Overview > Central carbon metabolism in cancer. (View pathway)
· Metabolism > Carbohydrate metabolism > Glycolysis / Gluconeogenesis.
· Metabolism > Amino acid metabolism > Cysteine and methionine metabolism.
· Metabolism > Carbohydrate metabolism > Pyruvate metabolism.
· Metabolism > Carbohydrate metabolism > Propanoate metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
· Organismal Systems > Endocrine system > Glucagon signaling pathway.
References
1). Dioscin ameliorates murine ulcerative colitis by regulating macrophage polarization. Pharmacological research, 2021
(PubMed: 34343656)
[IF=9.3]
2). Bruceine A induces cell growth inhibition and apoptosis through PFKFB4/GSK3β signaling in pancreatic cancer. PHARMACOLOGICAL RESEARCH, 2021
(PubMed: 33992797)
[IF=9.3]
Application: WB Species: human Sample: MIA PaCa-2 cells
Fig. 4. | Bruceine A induces cell growth inhibition and apoptosis via PFKFB4-mediated glycolysis in MIA PaCa-2 cells. (C) MIA PaCa-2 cells were treated with various concentrations of bruceine A for 24 h. Protein levels of GLUT1, HK2, PFKFB4, PFKM, PKM2, LDHA, and β-actin were detected. β-actin was served was as control. Results were expressed as means ± SD of three independent experiments. *p < 0.05, **p < 0.01, ***p < 0.001 versus control cultured with 0.1% DMSO by one-way ANOVA and post hoc tests.
3). Agrimoniin sensitizes pancreatic cancer to apoptosis through ROS-mediated energy metabolism dysfunction. Phytomedicine, 2022
(PubMed: 34785107)
[IF=7.9]
4). Pimozide inhibits the growth of breast cancer cells by alleviating the Warburg effect through the P53 signaling pathway. BIOMEDICINE & PHARMACOTHERAPY, 2022
(PubMed: 35658233)
[IF=7.5]
Application: WB Species: Human Sample: MCF-7 cells
Fig. 3. Pimozide inhibits PKM2 protein and mRNA in both MCF-7 and MDA-MB-231 cells in vitro. (A-B) Cells were treated with the indicated concentrations of Pimozide for 24 h, and the protein expression of glycolytic enzymes in MCF-7(A) and MDA-MB-231(B) cells were determined by Western blot analysis (left panel). Densitometry analysis was performed to assess the glycolytic enzymes protein expression (normalized to β-actin expression), PKM2 decreased significantly compared with untreated cells (right panel). (C-D) The mRNA expression of PKM2 in MCF-7(C) and MDA-MB-231(D) cells untreated or treated with Pimozide was determined by qRT-PCR. GAPDH was used as a control. Data represent mean ± SD from three biological replicates (*p < 0.05, **p < 0.01).
5). Oxamate Attenuates Glycolysis and ER Stress in Silicotic Mice. INTERNATIONAL JOURNAL OF MOLECULAR SCIENCES, 2022
(PubMed: 35328434)
[IF=5.6]
Application: WB Species: Mice Sample: lung tissues
Figure 7
Oxamate reduced glycolysis and ER stress in silicotic mice. (A) HE. staining of lung tissue in mice exposed to silica (scale bar = 100 µm). (B) Sirius red staining of lung tissue in mice exposed to silica (scale bar = 50 µm). (C) Expression of LDHA in mice exposed to silica measured by IF staining (scale bar = 50 µm). (D) Expression of p-PERK in silicotic mice measured by IF staining (scale bar) = 50 µm. (E) Positive expression of p-IRE-1α in silicotic mice observed by IHC staining (scale bar = 50 µm). (F) Expression levels of collagen type I (Col I), LDHA, p-PERK, and p-IRE-1α in mice lungs measured by Western blotting. Data are presented as the mean ± SD, n = 6 per group.
6). Activation of Cannabinoid Type 2 Receptor in Microglia Reduces Neuroinflammation through Inhibiting Aerobic Glycolysis to Relieve Hypertension. Biomolecules, 2024
(PubMed: 38540753)
[IF=5.5]
Application: WB Species: Mouse Sample:
Figure 1 JWH133 (2 mg/kg, 28 days) activated the CB2 receptor on microglia to inhibit AngII-induced hypertension by suppressing glycolytic enzymes and proinflammatory cytokines in the PVN. (a) The expression of the CB2 receptor in microglia was upregulated in the PVN of AngII-induced hypertension mice. Iba1 (blue) and CB2 receptor (red). Scale bar = 10 μm. JWH133 activation of the CB2 receptor inhibited MAP (b), plasma norepinephrine levels (c), proinflammatory factors TNF-α, IL-1β, and IL-6 production (d), glycolytic enzymes PFK and LDHa expression (e) in AngII-induced hypertension mice. The results are expressed as mean ±SEM (n = 5 mice in each group, * p < 0.05, ** p < 0.01, *** p < 0.001). Original blot images can be found in Supplementary File S1.
7). Icaritin activates p53 and inhibits aerobic glycolysis in liver cancer cells. Chemico-biological interactions, 2024
(PubMed: 38431053)
[IF=5.1]
8). AMPK/GSK3β/β-catenin cascade-triggered overexpression of CEMIP promotes migration and invasion in anoikis-resistant prostate cancer cells by enhancing metabolic reprogramming. FASEB JOURNAL, 2018
(PubMed: 29505302)
[IF=4.8]
9). The miR-34a-LDHA axis regulates glucose metabolism and tumor growth in breast cancer. Scientific Reports, 2016
(PubMed: 26902416)
[IF=4.6]
Application: WB Species: human Sample: breast cancer
10). Indole-3-Carbinol Stabilizes p53 to Induce miR-34a, Which Targets LDHA to Block Aerobic Glycolysis in Liver Cancer Cells. Pharmaceuticals, 2022
(PubMed: 36297369)
[IF=4.6]
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.