VHL Antibody - #DF6104
Product: | VHL Antibody |
Catalog: | DF6104 |
Description: | Rabbit polyclonal antibody to VHL |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Dog |
Mol.Wt.: | 24kDa; 24kD(Calculated). |
Uniprot: | P40337 |
RRID: | AB_2838072 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6104, RRID:AB_2838072.
Fold/Unfold
Elongin binding protein; G7 protein; HRCA 1; HRCA1; Protein G7; pVHL; RCA 1; RCA1; VHL 1; VHL; VHL_HUMAN; VHL1; VHLH; Von Hippel Lindau disease tumor suppressor; von Hippel Lindau syndrome; von Hippel Lindau tumor suppressor; Von Hippel Lindau tumor suppressor, E3 ubiquitin protein ligase; Von Hippel-Lindau disease tumor suppressor;
Immunogens
- P40337 VHL_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P40337 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S33 | Phosphorylation | P68400 (CSNK2A1) | Uniprot |
S38 | Phosphorylation | P68400 (CSNK2A1) | Uniprot |
S43 | Phosphorylation | P68400 (CSNK2A1) | Uniprot |
S68 | Phosphorylation | P49841 (GSK3B) | Uniprot |
S72 | Phosphorylation | O14965 (AURKA) , P48729 (CSNK1A1) | Uniprot |
R79 | Methylation | Uniprot | |
S80 | Phosphorylation | Uniprot | |
T100 | Phosphorylation | Q96PY6 (NEK1) | Uniprot |
T105 | Phosphorylation | Q96PY6 (NEK1) | Uniprot |
S111 | Phosphorylation | O96017 (CHEK2) | Uniprot |
Y112 | Phosphorylation | Q96PY6 (NEK1) | Uniprot |
K159 | Ubiquitination | Uniprot | |
S168 | Phosphorylation | Q96PY6 (NEK1) | Uniprot |
K171 | Sumoylation | Uniprot | |
K171 | Ubiquitination | Uniprot | |
Y175 | Phosphorylation | Q96PY6 (NEK1) | Uniprot |
S183 | Phosphorylation | Q96PY6 (NEK1) | Uniprot |
Y185 | Phosphorylation | Uniprot | |
K196 | Ubiquitination | Uniprot | |
T202 | Phosphorylation | Q96PY6 (NEK1) | Uniprot |
Research Backgrounds
Involved in the ubiquitination and subsequent proteasomal degradation via the von Hippel-Lindau ubiquitination complex. Seems to act as a target recruitment subunit in the E3 ubiquitin ligase complex and recruits hydroxylated hypoxia-inducible factor (HIF) under normoxic conditions. Involved in transcriptional repression through interaction with HIF1A, HIF1AN and histone deacetylases. Ubiquitinates, in an oxygen-responsive manner, ADRB2.
Cytoplasm. Membrane>Peripheral membrane protein. Nucleus.
Note: Found predominantly in the cytoplasm and with less amounts nuclear or membrane-associated. Colocalizes with ADRB2 at the cell membrane.
Cytoplasm. Nucleus.
Note: Equally distributed between the nucleus and the cytoplasm but not membrane-associated.
Expressed in the adult and fetal brain and kidney.
Component of the VCB (VHL-Elongin BC-CUL2) complex; this complex acts as a ubiquitin-ligase E3 and directs proteasome-dependent degradation of targeted proteins. Interacts with CUL2; this interaction is dependent on the integrity of the trimeric VBC complex. Interacts (via the beta domain) with HIF1A (via the NTAD domain); this interaction mediates degradation of HIF1A in normoxia and, in hypoxia, prevents ubiquitination and degradation of HIF1A by mediating hypoxia-induced translocation to the nucleus, a process which requires a hypoxia-dependent regulatory signal. Interacts with ADRB2; the interaction, in normoxia, is dependent on hydroxylation of ADRB2 and the subsequent VCB-mediated ubiquitination and degradation of ADRB2. Under hypoxia, hydroxylation, interaction with VHL, ubiquitination and subsequent degradation of ADRB2 are dramatically decreased. Interacts with RNF139, USP33 and JADE1. Found in a complex composed of LIMD1, VHL, EGLN1/PHD2, ELOB and CUL2. Isoform 1 and isoform 3 interact with LIMD1 (via LIM zinc-binding 2), AJUBA (via LIM domains) and WTIP (via LIM domains). Interacts with EPAS1. Interacts with CARD9.
The Elongin BC complex binding domain is also known as BC-box with the consensus [APST]-L-x(3)-C-x(3)-[AILV].
Belongs to the VHL family.
Research Fields
· Environmental Information Processing > Signal transduction > HIF-1 signaling pathway. (View pathway)
· Genetic Information Processing > Folding, sorting and degradation > Ubiquitin mediated proteolysis. (View pathway)
· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)
· Human Diseases > Cancers: Specific types > Renal cell carcinoma. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.