ATF4 Antibody - #AF5416

(4)   (4)  
Product: ATF4 Antibody
Catalog: AF5416
Description: Rabbit polyclonal antibody to ATF4
Application: WB
Reactivity: Human, Mouse
Prediction: Pig, Bovine, Dog
Mol.Wt.: 39~49kD; 39kD(Calculated).
Uniprot: P18848
RRID: AB_2837900

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Prediction:
Pig(86%), Bovine(86%), Dog(86%)
Clonality:
Polyclonal
Specificity:
ATF4 Antibody detects endogenous levels of total ATF4.
RRID:
AB_2837900
Cite Format: Affinity Biosciences Cat# AF5416, RRID:AB_2837900.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Activating transcription factor 4; ATF 4; ATF4; ATF4 protein; ATF4_HUMAN; cAMP-dependent transcription factor ATF-4; cAMP-responsive element-binding protein 2; CREB 2; CREB-2; CREB2; Cyclic AMP dependent transcription factor ATF 4; Cyclic AMP response element binding protein 2; Cyclic AMP-dependent transcription factor ATF-4; Cyclic AMP-responsive element-binding protein 2; DNA binding protein TAXREB67; DNA-binding protein TAXREB67; Tax Responsive Enhancer Element B67; Tax-responsive enhancer element-binding protein 67; TaxREB67; TXREB;

Immunogens

Immunogen:
Uniprot:

P18848(ATF4_HUMAN) >>Visit HPA database.

Gene(ID):
ATF4(468)
Description:
Transcriptional activator. Binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Cooperates with FOXO1 in osteoblasts to regulate glucose homeostasis through suppression of beta-cell production and decrease in insulin production
Sequence:
MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
86
Bovine
86
Dog
86
Horse
0
Sheep
0
Xenopus
0
Zebrafish
0
Chicken
0
Rabbit
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P18848 As Substrate

Site PTM Type Enzyme
K45 Sumoylation
K45 Ubiquitination
K53 Sumoylation
K53 Ubiquitination
K55 Ubiquitination
S69 Phosphorylation
K75 Ubiquitination
K88 Ubiquitination
T107 Phosphorylation P07949 (RET)
T114 Phosphorylation P07949 (RET)
T115 Phosphorylation P07949 (RET)
T119 Phosphorylation P07949 (RET)
S215 Phosphorylation
S219 Phosphorylation
S224 Phosphorylation
S245 Phosphorylation P51812 (RPS6KA3)
S248 Phosphorylation
K259 Ubiquitination
K267 Sumoylation
K267 Ubiquitination
K277 Ubiquitination
T293 Phosphorylation
Y295 Phosphorylation
K299 Ubiquitination
K311 Acetylation PR:000007102 (EP300)
K329 Ubiquitination
K335 Ubiquitination
K343 Acetylation
K348 Acetylation

Research Backgrounds

Function:

Transcriptional activator. Binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Cooperates with FOXO1 in osteoblasts to regulate glucose homeostasis through suppression of beta-cell production and decrease in insulin production (By similarity). It binds to a Tax-responsive enhancer element in the long terminal repeat of HTLV-I. Regulates the induction of DDIT3/CHOP and asparagine synthetase (ASNS) in response to endoplasmic reticulum (ER) stress. In concert with DDIT3/CHOP, activates the transcription of TRIB3 and promotes ER stress-induced neuronal apoptosis by regulating the transcriptional induction of BBC3/PUMA. Activates transcription of SIRT4. Regulates the circadian expression of the core clock component PER2 and the serotonin transporter SLC6A4. Binds in a circadian time-dependent manner to the cAMP response elements (CRE) in the SLC6A4 and PER2 promoters and periodically activates the transcription of these genes. During ER stress response, activates the transcription of NLRP1, possibly in concert with other factors.

PTMs:

Ubiquitinated by SCF(BTRC) in response to mTORC1 signal, followed by proteasomal degradation and leading to down-regulate expression of SIRT4.

Phosphorylated by NEK6 (By similarity). Phosphorylated on the betaTrCP degron motif at Ser-219, followed by phosphorylation at Thr-213, Ser-224, Ser-231, Ser-235 and Ser-248, promoting interaction with BTRC and ubiquitination. Phosphorylation is promoted by mTORC1 (By similarity).

Phosphorylated by NEK6.

Subcellular Location:

Cytoplasm. Cell membrane. Nucleus. Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome.
Note: Colocalizes with GABBR1 in hippocampal neuron dendritic membranes (By similarity). Colocalizes with NEK6 at the centrosome (PubMed:20873783).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Binds DNA as a homodimer and as a heterodimer. Interacts with CEBPB and binds DNA as a heterodimer with CEBPB. Interacts (via its leucine zipper domain) with GABBR1 and GABBR2 (via their C-termini). Interacts (via its DNA binding domain) with FOXO1 (C-terminal half); the interaction occurs in osteoblasts and regulates glucose homeostasis through suppression of beta-cell proliferation and a decrease in insulin production. Interacts with SATB2; the interaction results in enhanced DNA binding and transactivation by these transcription factors (By similarity). Interacts with CEP290 (via an N-terminal region). Interacts with NEK6, DAPK2 (isoform 2) and ZIPK/DAPK3. Forms a heterodimer with TXLNG in osteoblasts. Interacts with DDIT3/CHOP. Interacts with ABRAXAS2.

Family&Domains:

The BetaTrCP degron motif promotes binding to BTRC when phosphorylated.

Belongs to the bZIP family.

Research Fields

· Cellular Processes > Cell growth and death > Apoptosis.   (View pathway)

· Environmental Information Processing > Signal transduction > MAPK signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > cGMP-PKG signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > TNF signaling pathway.   (View pathway)

· Genetic Information Processing > Folding, sorting and degradation > Protein processing in endoplasmic reticulum.   (View pathway)

· Human Diseases > Endocrine and metabolic diseases > Non-alcoholic fatty liver disease (NAFLD).

· Human Diseases > Substance dependence > Cocaine addiction.

· Human Diseases > Substance dependence > Amphetamine addiction.

· Human Diseases > Substance dependence > Alcoholism.

· Human Diseases > Infectious diseases: Viral > Hepatitis B.

· Human Diseases > Infectious diseases: Viral > HTLV-I infection.

· Human Diseases > Cancers: Overview > Viral carcinogenesis.

· Human Diseases > Cancers: Specific types > Prostate cancer.   (View pathway)

· Organismal Systems > Aging > Longevity regulating pathway.   (View pathway)

· Organismal Systems > Circulatory system > Adrenergic signaling in cardiomyocytes.   (View pathway)

· Organismal Systems > Nervous system > Long-term potentiation.

· Organismal Systems > Nervous system > Neurotrophin signaling pathway.   (View pathway)

· Organismal Systems > Nervous system > Cholinergic synapse.

· Organismal Systems > Nervous system > Dopaminergic synapse.

· Organismal Systems > Endocrine system > Insulin secretion.   (View pathway)

· Organismal Systems > Endocrine system > Estrogen signaling pathway.   (View pathway)

· Organismal Systems > Endocrine system > Thyroid hormone synthesis.

· Organismal Systems > Endocrine system > Glucagon signaling pathway.

· Organismal Systems > Endocrine system > Aldosterone synthesis and secretion.

· Organismal Systems > Endocrine system > Relaxin signaling pathway.

References

1). EndophilinA2 protects against angiotensin II-induced cardiac hypertrophy by inhibiting angiotensin II type 1 receptor trafficking in neonatal rat cardiomyocytes. JOURNAL OF CELLULAR BIOCHEMISTRY, 2018 (PubMed: 29923351) [IF=4.0]

Application: WB    Species: rat    Sample: cardiomyocytes

FIGURE 4| EndoA2 modulated the MAPK signaling pathway in response to ERS. A-F, Western blotting results show the expression levels of GRP78, p-PERK, p-eiF2α, ATF4, and CHOP after EndoA2 overexpression. Densitometric analyses show that EndoA2 overexpression decreased the expression levels of GRP78, p-PERK, p-eiF2α, ATF4, and CHOP, compared with those in the Ang II group. Transfection with AdlacZ had no significant effects (n = 5, *P < 0.05 vs control, #P < 0.05 vs Ang II).
2). POU4F3 Acts as a Tumor Suppressor in Lung Adenocarcinoma via the Endoplasmic Reticulum Stress Signaling Pathway. Journal of Cancer, 2022 (PubMed: 35069902) [IF=3.9]

Application: WB    Species: Human    Sample: LUAD cells

Figure 4 POU4F3 activated the ERS pathways in LUAD cells according to WB. A. The protein levels of PERK, p-PERK, eIF2α, p-eIF2α, ATF4, and CHOP in SPCA1 and A549 cells with or without POU4F3 overexpression, and with or without POU4F3 knockdown, were detected by WB. B. The protein levels of IRElα, p-IRElα, and XBP-1s in SPCA1 and A549 cells with or without POU4F3 overexpression, and with or without POU4F3 knockdown, were detected by WB.' ****', '***', and '**' represent P < 0.0001, 0.001, and 0.01 respectively.
3). Inhibition of the SIRT1 signaling pathway exacerbates endoplasmic reticulum stress induced by renal ischemia/reperfusion injury in type 1 diabetic rats. Molecular Medicine Reports, 2020 (PubMed: 31974604) [IF=3.4]

Application: WB    Species: rat    Sample: renal

Figure 3. |DM enhances endoplasmic reticulum stress. Western blot analysis was performed after 24 h of reperfusion. (A) Representative blots and histograms showing (B) p‑PERK/PERK ratio; (C) p‑eIF2α/eIF2α ratio; (D) ATF4 expression; and (E) CHOP expression.
4). Antitumor effect of ginsenoside Rg3 on gallbladder cancer by inducing endoplasmic reticulum stress-mediated apoptosis in vitro and in vivo. Oncology Letters, 2018 (PubMed: 30344724) [IF=2.9]

Application: WB    Species: human    Sample: GBC‑SD cells

Figure 1. |Rg3 activates ER stress in GBC‑SD cells. (A) GBC‑SD cells were treated with 1, 25, 50 and 100 µM Rg3 for 72 h, and proliferation was determined using a CCK‑8 kit. (B) Rg3 induced p‑eIF2α, ATF4 and Lcn2 expression in GBC‑SD cells. Relative protein expression level of (C) eIF2α, (D) p‑eIF2α, (E) ATF4 and (F) Lcn2 compared with the DMSO group. Relative protein expression was quantified by normalizing to the internal control β‑actin (n=3). *P<0.05, **P<0.01 vs. DMSO group. OD, optical density; ER, endoplasmic reticulum; eIF2α, eukaryotic translation‑initiation factor 2α; ATF4, activating transcription factor 4; p‑, phospho‑; DMSO, dimethylsulfoxide; Lcn2, lipocalin 2.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.