HO-1 Antibody - #AF5393

(102)   (57)  
Product: HO-1 Antibody
Catalog: AF5393
Description: Rabbit polyclonal antibody to HO-1
Application: WB IHC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 33 kDa; 33kD(Calculated).
Uniprot: P09601
RRID: AB_2837878

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
HO-1 Antibody detects endogenous levels of total HO-1.
RRID:
AB_2837878
Cite Format: Affinity Biosciences Cat# AF5393, RRID:AB_2837878.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

32 kD; bK286B10; D8Wsu38e; heat shock protein 32 kD; heat shock protein 32kD; Heat shock protein; Heme oxygenase (decycling) 1; Heme oxygenase 1; Hemox; HMOX 1; Hmox; Hmox1; HMOX1_HUMAN; HO 1; HO; HO-1; HO1; Hsp32;

Immunogens

Immunogen:
Uniprot:

P09601(HMOX1_HUMAN) >>Visit HPA database.

Gene(ID):
HMOX1(3162)
Expression:
P09601 HMOX1_HUMAN:

Expressed at higher levels in renal cancer tissue than in normal tissue (at protein level).

Description:
Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed.
Sequence:
MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM

PTMs - P09601 As Substrate

Site PTM Type Enzyme
K18 Acetylation
K18 Ubiquitination
K22 Ubiquitination
K39 Acetylation
K39 Ubiquitination
S53 Phosphorylation
Y55 Phosphorylation
Y58 Phosphorylation
K69 Ubiquitination
K86 Ubiquitination
T108 Phosphorylation
Y114 Phosphorylation
Y137 Phosphorylation
K148 Ubiquitination
K149 Ubiquitination
K153 Ubiquitination
S160 Phosphorylation
K177 Ubiquitination
K179 Ubiquitination
S188 Phosphorylation P31749 (AKT1)
T192 Phosphorylation
S229 Phosphorylation
S231 Phosphorylation
K243 Acetylation
K243 Ubiquitination
T252 Phosphorylation
K256 Acetylation
K256 Ubiquitination
Y286 Phosphorylation

Research Backgrounds

Function:

Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. Exhibits cytoprotective effects since excess of free heme sensitizes cells to undergo apoptosis.

Subcellular Location:

Microsome. Endoplasmic reticulum membrane>Peripheral membrane protein>Cytoplasmic side.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed at higher levels in renal cancer tissue than in normal tissue (at protein level).

Family&Domains:

Belongs to the heme oxygenase family.

Research Fields

· Cellular Processes > Cell growth and death > Ferroptosis.   (View pathway)

· Environmental Information Processing > Signal transduction > HIF-1 signaling pathway.   (View pathway)

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > MicroRNAs in cancer.

· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma.   (View pathway)

· Metabolism > Metabolism of cofactors and vitamins > Porphyrin and chlorophyll metabolism.

· Metabolism > Global and overview maps > Metabolic pathways.

· Organismal Systems > Digestive system > Mineral absorption.

References

1). Mitochondria-targeted supramolecular coordination container encapsulated with exogenous itaconate for synergistic therapy of joint inflammation. Theranostics, 2023 (PubMed: 35547753) [IF=12.4]
2). Ultrasmall PtAu2 nanoclusters activate endogenous anti-inflammatory and anti-oxidative systems to prevent inflammatory osteolysis. Theranostics, 2023 (PubMed: 36793859) [IF=12.4]
3). Cetuximab promotes RSL3-induced ferroptosis by suppressing the Nrf2/HO-1 signalling pathway in KRAS mutant colorectal cancer. Cell Death & Disease, 2021 (PubMed: 34775496) [IF=9.0]

Application: WB    Species: Human    Sample: HCT116 and DLD-1 cells

Fig. 3 Combination treatment with RSL3 and cetuximab inhibits Nrf2/HO-1 axis in KRAS mutant CRC cells. A The protein levels of Keap1, Nrf2 and HO-1 in HCT116 and DLD-1 cells were measured by western blotting after treatment with RSL3 (1 μM), cetuximab (100 μg/ml) or their combination for 24 h. B Knockdown of Nrf2 by siRNA reduced the expression of Nrf2 and the protein levels of Nrf2 and HO-1 after treatment with RSL3 (1 μM) for 24 h. C siRNA-mediated knockdown of Nrf2 increased the sensitivity of HCT116 and DLD-1 cells to RSL3. D–F The levels of MDA, lipid ROS and intracellular iron were measured in Nrf2-silenced HCT116 and DLD-1 cells pretreated with or without RSL3 (1 μM). Scale bar, 100 μm. **P < 0.01; *P < 0.05.
4). Cytotoxicity of adducts formed between quercetin and methylglyoxal in PC-12 cells. Food Chemistry, 2021 (PubMed: 33706136) [IF=8.8]

Application: WB    Species: Rat    Sample: PC-12 cells

Fig. 5. Effect of treatments of MGO, Que-mono-MGO, and Que-di-MGO on the expression levels of apoptotic markers and components of AKT and Nrf2-HO-1/NQO-1 signaling pathways. Significant differences (p < 0.05) between samples of different treatments are marked with different letters on each column.
5). Total flavonoids of Inula japonica alleviated the inflammatory response and oxidative stress in LPS-induced acute lung injury via inhibiting the sEH activity: Insights from lipid metabolomics. PHYTOMEDICINE, 2022 (PubMed: 36150346) [IF=7.9]
6). Agrimoniin sensitizes pancreatic cancer to apoptosis through ROS-mediated energy metabolism dysfunction. Phytomedicine, 2022 (PubMed: 34785107) [IF=7.9]
7). d-Borneol enhances cisplatin sensitivity via autophagy dependent EMT signaling and NCOA4-mediated ferritinophagy. PHYTOMEDICINE, 2022 (PubMed: 36030746) [IF=7.9]
8). Naringenin protects against iron overload-induced osteoarthritis by suppressing oxidative stress. PHYTOMEDICINE, 2022 (PubMed: 35905566) [IF=7.9]
9). 8-Oxypalmatine, a novel oxidative metabolite of palmatine, exhibits superior anti-colitis effect via regulating Nrf2 and NLRP3 inflammasome. BIOMEDICINE & PHARMACOTHERAPY, 2022 (PubMed: 35779424) [IF=7.5]
10). The effect of monotropein on alleviating cisplatin-induced acute kidney injury by inhibiting oxidative damage, inflammation and apoptosis. BIOMEDICINE & PHARMACOTHERAPY, 2020 (PubMed: 32574971) [IF=7.5]

Application: WB    Species: Human    Sample: kidney tissue

Fig. 2. Pretreatment with monotropein protected against renal oxidative stress induced by cisplatin. The level of serum GSH(A). The level of serum MDA(B). The level of serum SOD(C). The level of serum CAT(D). The protein expressions of Nrf2, HO-1 and NQO1 (E) were detected by Western blot in kidney tissue. The protein expressions of Nrf2 (F), HO-1 (G) and NQO1 (H) were quantitated by Image software. Data are showed as mean ± S.E.M of 6 mice in each group. #P < 0.05, ##P < 0.01 vs. Normal group; *P < 0.05, **P < 0.01 vs. cisplatin group.
Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.