Product: CD40 Antibody
Catalog: AF5336
Description: Rabbit polyclonal antibody to CD40
Application: WB IHC IF/ICC
Cited expt.: WB, IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken
Mol.Wt.: 31 kDa; 31kD(Calculated).
Uniprot: P25942
RRID: AB_2837821

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(92%), Horse(100%), Sheep(92%), Rabbit(92%), Dog(100%), Chicken(85%)
Clonality:
Polyclonal
Specificity:
CD40 Antibody detects endogenous levels of total CD40.
RRID:
AB_2837821
Cite Format: Affinity Biosciences Cat# AF5336, RRID:AB_2837821.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

AI326936; B cell associated molecule CD40; B cell surface antigen CD40; B cell-associated molecule; B-cell surface antigen CD40; Bp50; CD 40; CD40; CD40 antigen (TNF receptor superfamily member 5); CD40 antigen; CD40 molecule; CD40 molecule, TNF receptor superfamily member 5; CD40 protein; CD40 type II isoform; CD40L receptor; CDw40; GP39; HIGM1; IGM; IMD3; MGC9013; Nerve growth factor receptor related B lymphocyte activation molecule; OTTHUMP00000031699; OTTHUMP00000031700; p50; T-BAM; TBAM; TNF receptor superfamily member 5; TNFRSF5; TNR5_HUMAN; TRAP; Tumor necrosis factor receptor superfamily , member 5; Tumor necrosis factor receptor superfamily member 5; Tumor necrosis factor receptor superfamily member 5 precursor; Tumor necrosis factor receptor superfamily, member 5, isoform CRA_a;

Immunogens

Immunogen:

A synthesized peptide derived from human CD40, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
P25942 TNR5_HUMAN:

B-cells and in primary carcinomas.

Description:
Defects in CD40 are the cause of hyper-IgM immunodeficiency syndrome type 3 (HIGM3) [MIM:606843]; also known as hyper-IgM syndrome 3. HIGM3 is an autosomal recessive disorder which includes an inability of B cells to undergo isotype switching, one of the final differentiation steps in the humoral immune system, an inability to mount an antibody-specific immune response, and a lack of germinal center formation.
Sequence:
MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Dog
100
Bovine
92
Sheep
92
Rabbit
92
Chicken
85
Xenopus
62
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Receptor for TNFSF5/CD40LG. Transduces TRAF6- and MAP3K8-mediated signals that activate ERK in macrophages and B cells, leading to induction of immunoglobulin secretion (By similarity).

Subcellular Location:

Cell membrane>Single-pass type I membrane protein.

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

B-cells and in primary carcinomas.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Environmental Information Processing > Signal transduction > NF-kappa B signaling pathway.   (View pathway)

· Environmental Information Processing > Signaling molecules and interaction > Cell adhesion molecules (CAMs).   (View pathway)

· Human Diseases > Infectious diseases: Parasitic > Malaria.

· Human Diseases > Infectious diseases: Parasitic > Toxoplasmosis.

· Human Diseases > Infectious diseases: Viral > HTLV-I infection.

· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.

· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.

· Human Diseases > Immune diseases > Asthma.

· Human Diseases > Immune diseases > Autoimmune thyroid disease.

· Human Diseases > Immune diseases > Systemic lupus erythematosus.

· Human Diseases > Immune diseases > Allograft rejection.

· Human Diseases > Immune diseases > Primary immunodeficiency.

· Human Diseases > Cardiovascular diseases > Viral myocarditis.

· Organismal Systems > Immune system > Toll-like receptor signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Intestinal immune network for IgA production.   (View pathway)

References

1). RNA aptamers with specific binding affinity to CD40 (CD40Apt) represents a promising antagonist of the CD40-CD40L signaling for thyroid-associated ophthalmopathy (TAO) treatment in mouse. Journal of translational medicine, 2023 (PubMed: 37331977) [IF=7.4]

2). An IgD-Fc-Ig fusion protein restrains the activation of T and B cells by inhibiting IgD-IgDR-Lck signaling in rheumatoid arthritis. Acta pharmacologica Sinica, 2022 (PubMed: 33864023) [IF=6.9]

3). Involvement of CD40-CD40L and ICOS-ICOSL in the development of chronic rhinosinusitis by targeting eosinophils. Frontiers in Immunology, 2023 (PubMed: 37325657) [IF=5.7]

Application: IHC    Species: Human    Sample: nasal tissues

Figure 1 The expression of CD40, CD40L, ICOS, and ICOSL in nasal tissues of patients with ECRS and non-eCRS. (A) The representative immunohistochemistry stainings of CD40, CD40L, ICOS, and ICOSL. Original magnification, ×400. (B) The mean numbers of CD40+ (non-eCRS, n = 19; ECRS, n = 9), CD40L+ (non-eCRS, n = 15; ECRS, n = 9), ICOS+ (non-eCRS, n = 12; ECRS, n = 8), and ICOSL+ (non-eCRS, n = 15; ECRS, n = 10) cells in nasal tissues.

4). Suppression of TLR4 prevents diabetic bone loss by regulating FTO-mediated m6A modification. International immunopharmacology, 2023 (PubMed: 37413932) [IF=4.8]

5). CD147 monoclonal antibody attenuates abdominal aortic aneurysm formation in angiotensin II-Infused apoE-/- mice. International immunopharmacology, 2023 (PubMed: 37393837) [IF=4.8]

6). The role and molecular mechanism of gut microbiota in Graves' orbitopathy. Journal of endocrinological investigation, 2023 (PubMed: 35986869) [IF=3.9]

7). Effects of dietary selenium on immune function of spleen in mice. Journal of Functional Foods, 2022 [IF=3.8]

Application: WB    Species: Mouse    Sample:

Fig. 7. Verification of differential proteins using Western blotting. (A) Protein levels of Fyn, Lyn, granzyme A, Rfx1, Btk, CD40, CD74 and Rab27b in the spleen of mice fed with selenium were detected using Western blotting, (B) the density values relative to Gapdh were analysed (n = 4). Data are presented as mean ± standard deviation. *p < 0.05, **p < 0.01, ***p < 0.001, compared with medium selenium.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.