IL12A Antibody - #AF5133
![](/images/pubmed.gif)
Product: | IL12A Antibody |
Catalog: | AF5133 |
Description: | Rabbit polyclonal antibody to IL12A |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 24 kDa; 25kD(Calculated). |
Uniprot: | P29459 |
RRID: | AB_2837619 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF5133, RRID:AB_2837619.
Fold/Unfold
CLMF; CLMF p35; Cytotoxic lymphocyte maturation factor 1 p35; Cytotoxic lymphocyte maturation factor 35 kDa subunit; IL 12 subunit p35; IL 12A; IL-12 subunit p35; IL-12A; IL12A; IL12A_HUMAN; IL35; IL35 subunit; Interleukin 12 alpha chain; Interleukin 12 p35; Interleukin 12 subunit alpha; Interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35); Interleukin-12 subunit alpha; Natural killer cell stimulatory factor 1 35 kD subunit; NF cell stimulatory factor chain 1; NFSK; NK cell stimulatory factor chain 1; NKSF1; P35;
Immunogens
- P29459 IL12A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P29459 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T102 | Phosphorylation | Uniprot | |
T106 | Phosphorylation | Uniprot | |
S125 | Phosphorylation | Uniprot | |
S126 | Phosphorylation | Uniprot | |
Y128 | Phosphorylation | Uniprot |
Research Backgrounds
Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC.
Secreted.
Heterodimer with IL12B; disulfide-linked. This heterodimer is known as interleukin IL-12. Heterodimer with EBI3/IL27B; not disulfide-linked. This heterodimer is known as interleukin IL-35.
Belongs to the IL-6 superfamily.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway. (View pathway)
· Human Diseases > Endocrine and metabolic diseases > Type I diabetes mellitus.
· Human Diseases > Infectious diseases: Bacterial > Pertussis.
· Human Diseases > Infectious diseases: Bacterial > Legionellosis.
· Human Diseases > Infectious diseases: Parasitic > Leishmaniasis.
· Human Diseases > Infectious diseases: Parasitic > Chagas disease (American trypanosomiasis).
· Human Diseases > Infectious diseases: Parasitic > African trypanosomiasis.
· Human Diseases > Infectious diseases: Parasitic > Malaria.
· Human Diseases > Infectious diseases: Parasitic > Toxoplasmosis.
· Human Diseases > Infectious diseases: Parasitic > Amoebiasis.
· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.
· Human Diseases > Infectious diseases: Viral > Measles.
· Human Diseases > Infectious diseases: Viral > Influenza A.
· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.
· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)
· Human Diseases > Immune diseases > Inflammatory bowel disease (IBD).
· Human Diseases > Immune diseases > Allograft rejection.
· Organismal Systems > Immune system > Toll-like receptor signaling pathway. (View pathway)
· Organismal Systems > Immune system > RIG-I-like receptor signaling pathway. (View pathway)
· Organismal Systems > Immune system > Th1 and Th2 cell differentiation. (View pathway)
References
Application: WB Species: Mouse Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.