VEGFA Antibody - #AF5131

(172)   (70)  
Product: VEGFA Antibody
Catalog: AF5131
Description: Rabbit polyclonal antibody to VEGFA
Application: WB IHC IF/ICC
Cited expt.: WB, IHC, IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 16-20kDa,25-30kDa,40-45kDa; 27kD(Calculated).
Uniprot: P15692
RRID: AB_2837617

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(89%), Horse(89%), Sheep(90%), Rabbit(100%), Dog(100%)
Clonality:
Polyclonal
Specificity:
VEGFA Antibody detects endogenous levels of total VEGFA.
RRID:
AB_2837617
Cite Format: Affinity Biosciences Cat# AF5131, RRID:AB_2837617.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Folliculostellate cell-derived growth factor; Glioma-derived endothelial cell mitogen; MGC70609; MVCD1; Vascular endothelial growth factor A; vascular endothelial growth factor A121; vascular endothelial growth factor A165; vascular endothelial growth factor; Vascular permeability factor; VEGF A; Vegf; VEGF-A; VEGF120; Vegfa; VEGFA_HUMAN; VPF;

Immunogens

Immunogen:

A synthesized peptide derived from human VEGFA, corresponding to a region within the internal amino acids.

Uniprot:

P15692(VEGFA_HUMAN) >>Visit HPA database.

Gene(ID):
VEGFA(7422)
Expression:
P15692 VEGFA_HUMAN:

Isoform VEGF189, isoform VEGF165 and isoform VEGF121 are widely expressed. Isoform VEGF206 and isoform VEGF145 are not widely expressed. A higher level expression seen in pituitary tumors as compared to the pituitary gland.

Description:
Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin
Sequence:
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Dog
100
Rabbit
100
Sheep
90
Horse
89
Bovine
89
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth. Binding to NRP1 receptor initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development (By similarity).

Subcellular Location:

Secreted.
Note: VEGF121 is acidic and freely secreted. VEGF165 is more basic, has heparin-binding properties and, although a significant proportion remains cell-associated, most is freely secreted. VEGF189 is very basic, it is cell-associated after secretion and is bound avidly by heparin and the extracellular matrix, although it may be released as a soluble form by heparin, heparinase or plasmin.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Isoform VEGF189, isoform VEGF165 and isoform VEGF121 are widely expressed. Isoform VEGF206 and isoform VEGF145 are not widely expressed. A higher level expression seen in pituitary tumors as compared to the pituitary gland.

Family&Domains:

Belongs to the PDGF/VEGF growth factor family.

Research Fields

· Cellular Processes > Cellular community - eukaryotes > Focal adhesion.   (View pathway)

· Environmental Information Processing > Signal transduction > MAPK signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Ras signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Rap1 signaling pathway.   (View pathway)

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Environmental Information Processing > Signal transduction > HIF-1 signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.   (View pathway)

· Human Diseases > Drug resistance: Antineoplastic > EGFR tyrosine kinase inhibitor resistance.

· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > Proteoglycans in cancer.

· Human Diseases > Cancers: Overview > MicroRNAs in cancer.

· Human Diseases > Cancers: Specific types > Renal cell carcinoma.   (View pathway)

· Human Diseases > Cancers: Specific types > Pancreatic cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Bladder cancer.   (View pathway)

· Human Diseases > Immune diseases > Rheumatoid arthritis.

· Organismal Systems > Endocrine system > Relaxin signaling pathway.

References

1). Microenvironment-responsive multifunctional enzyme-linked hydrogel for diabetic bone defect regeneration. Nature communications, 2025 (PubMed: 41271711) [IF=16.6]
2). Upregulation of BCL-2 by acridone derivative through gene promoter i-motif for alleviating liver damage of NAFLD/NASH. NUCLEIC ACIDS RESEARCH, 2020 (PubMed: 32710621) [IF=16.6]

Application: WB    Species: human    Sample: HepG2

Figure 3. Effect of A22 on gene transcription and translation in HepG2 cells. The mRNA levels of BCL-2 and BAX (A), as well as C-KIT, KRAS, C-MYC and VEGF (B) in HepG2 cells were analyzed by using qRT-PCR after incubation with increasing concentration of A22 for 12 h. (C) Effects of A22 on protein expressions of C-MYC, VEGF, C-KIT and BCL-2 in the presence or absence of increasing concentration of A22 for 24 h, which were quantitatively analyzed
3). Fluoropolymer Coated DNA Nanoclews for Volumetric Visualization of Oligonucleotides Delivery and Near Infrared Light Activated Anti-Angiogenic Oncotherapy. Advanced science (Weinheim, Baden-Wurttemberg, Germany), 2023 (PubMed: 37768835) [IF=15.1]
4). Gene-activated engineered exosome directs osteoblastic differentiation of progenitor cells and induces vascularized osteogenesis in situ. Chemical Engineering Journal, 2020 [IF=13.3]
5). Injectable Hydrogel Loaded with Plasma-Rich Platelets Repairing Endometrial Injury and Remodeling Reproductive Function by Regulating PI3K/AKT Pathway. Small (Weinheim an der Bergstrasse, Germany), 2025 (PubMed: 40165776) [IF=13.0]
6). A Di-aptamer-functionalized scaffold promotes bone regeneration by facilitating the selective retention of MSCs and EPCs and then promoting crosstalk between osteogenesis and angiogenesis. Biomaterials, 2025 (PubMed: 39985977) [IF=12.8]
7). Polydatin accelerates osteoporotic bone repair by inducing the osteogenesis-angiogenesis coupling of bone marrow mesenchymal stem cells via the PI3K/AKT/GSK-3β/β-catenin pathway. International journal of surgery (London, England), 2024 (PubMed: 39248296) [IF=12.5]

Application: WB    Species: Rat    Sample:

Figure 2. POL promoted BMSCs-mediated angiogenesis. (A-B) The protein expression levels of VEGFA and CD31 were evaluated by western blot (n = 3); (C-D) Immunofluorescence staining of VEGFA and CD31 (scale bar = 200 μm); (E) Images of transwell migration assay (scale bar = 100 μm); (F) Quantification of transwell migration assay (n = 5); (G) Images of scratch wound assay (scale bar = 100 μm); (H) Quantification of scratch wound assay (n = 5); (I) Images of tube formation assay (scale bar = 100 μm); (J) Quantification of tube formation assay (n = 5). Data were presented as mean ± SEM. Compared with control group: **P < 0.01, ***P < 0.001. Compared with 1 μM group: # P < 0.05, ##P < 0.01. Compared with CM + CON group: ^^^P < 0.001.

Application: IF/ICC    Species: Rat    Sample:

Figure 2. POL promoted BMSCs-mediated angiogenesis. (A-B) The protein expression levels of VEGFA and CD31 were evaluated by western blot (n = 3); (C-D) Immunofluorescence staining of VEGFA and CD31 (scale bar = 200 μm); (E) Images of transwell migration assay (scale bar = 100 μm); (F) Quantification of transwell migration assay (n = 5); (G) Images of scratch wound assay (scale bar = 100 μm); (H) Quantification of scratch wound assay (n = 5); (I) Images of tube formation assay (scale bar = 100 μm); (J) Quantification of tube formation assay (n = 5). Data were presented as mean ± SEM. Compared with control group: **P < 0.01, ***P < 0.001. Compared with 1 μM group: # P < 0.05, ##P < 0.01. Compared with CM + CON group: ^^^P < 0.001.
8). Polydatin accelerates osteoporotic bone repair by inducing the osteogenesis-angiogenesis coupling of bone marrow mesenchymal stem cells via the PI3K/AKT/GSK-3β/β-catenin pathway. International journal of surgery (London, England), 2025 (PubMed: 39248296) [IF=12.5]
9). Phenytoin silver: a new nanocompound for promoting dermal wound healing via comprehensive pharmacological action. Theranostics, 2017 (PubMed: 28255340) [IF=12.4]

Application: WB    Species: human    Sample:

Figure 6. PnAg regulates gp130/Jak/Stat3 signaling pathway (A) and (B) NIH-3T3 and HaCat Cells were treated with PnAg at different concentrations and cell viability was tested using MTT analysis. (C) Wound healing assay reflected the effect of PnAg on cell migration. (D) Binding mode of PnAg in the active pocket of gp130. (E) and (F) MMPs activity and expression levels of Stat3, VEGF, TGFB-1, and TGFB1 detected using zymographic and Western blot assays. (G) Diagram of the proposed function of PnAg in wound inflammation and re-epithelialization controls.
10). Built-In Electric Field Accelerates Nanotopography-Mediated Enhancement of Vascularized Osseointegration via Cav1.2/Piezo/Ca2+/PI3K Signaling. Small science, 2025 (PubMed: 41058722) [IF=11.1]

Application: IF/ICC    Species: human    Sample:

Figure 7 NBT and NBTP surfaces promote HUVEC spreading, proliferation, and angiogenesis. A) Confocal fluorescence images of HUVEC cytoskeleton (F-actin, yellow) and nuclei (blue) after 24 h of culture on different surfaces. B) Semiquantitative analysis of cell aspect ratio. C) Semiquantitative analysis of nucleus-to-cytoplasm ratio. D) CCK-8 proliferation assay on each surface after seeding for 1, 4, and 7 days. E) Tube formation assay after 7 days of culture. F) Semiquantitative analysis of tube formation parameters. G) mRNA expression of angiogenesis-related genes (eNOS, VEGF, HIF-1α). H) Immunofluorescence staining of CD31, VEGF, and eNOS and corresponding semiquantitative analysis. I) Immunofluorescent staining of Piezo1, vinculin, YAP, and Ca2+ and corresponding semiquantitative analysis. ANOVA followed by Tukey's post hoc test was performed for statistical analysis

Application: IHC    Species: Rat    Sample:

Figure 9 Enhanced angiogenesis through restored mechanobiological and piezoelectric microenvironment in vivo. A) CAM assay showing vascular networks formed around different implants. B) Semiquantitative analysis of vascular parameters from the CAM assay. C) Macroscopic analysis of implant size, shape, and morphology. D) Surgical site showing implant placement in rat femur. E) Methylene blue/basic fuchsin-stained sections at 4 weeks postimplantation (new bone=red, fibrous tissue=blue, implants=black). F) Quantitative analysis of BIC% at 4 weeks. G) Immunohistochemical staining of Col1 in peri-implant tissue at 4 weeks. H) Immunohistochemical staining of OPN in peri-implant tissue at 4 weeks. I) Immunohistochemical staining of CD31 in peri-implant tissue at 4 weeks. J) Immunohistochemical staining of VEGF in peri-implant tissue at 4 weeks. Target proteins appear deep brown. ANOVA followed by Tukey's post hoc test was performed for statistical analysis (error bar: ±SD; n = 3; *p 
Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.