Product: PDHK1 Antibody
Catalog: DF4365
Description: Rabbit polyclonal antibody to PDHK1
Application: WB IHC IF/ICC
Cited expt.: WB
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Dog, Chicken
Mol.Wt.: 49 KD; 49kD(Calculated).
Uniprot: Q15118
RRID: AB_2836733

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:1000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(91%), Horse(100%), Sheep(91%), Dog(82%), Chicken(80%)
Clonality:
Polyclonal
Specificity:
PDHK1 Antibody detects endogenous levels of total PDHK1.
RRID:
AB_2836733
Cite Format: Affinity Biosciences Cat# DF4365, RRID:AB_2836733.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

[Pyruvate dehydrogenase [lipoamide]] kinase isozyme 1, mitochondrial; HGNC:8809; Mitochondrial pyruvate dehydrogenase kinase isoenzyme 1; PDH kinase 1; Pdk1; PDK1_HUMAN; Pyruvate dehydrogenase kinase isoform 1; Pyruvate dehydrogenase kinase, isoenzyme 1;

Immunogens

Immunogen:

A synthesized peptide derived from human PDHK1, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
Q15118 PDK1_HUMAN:

Expressed predominantly in the heart. Detected at lower levels in liver, skeletal muscle and pancreas.

Sequence:
MRLARLLRGAALAGPGPGLRAAGFSRSFSSDSGSSPASERGVPGQVDFYARFSPSPLSMKQFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKGKGSPSHRKHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
91
Sheep
91
Dog
82
Chicken
80
Xenopus
78
Zebrafish
67
Rabbit
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Kinase that plays a key role in regulation of glucose and fatty acid metabolism and homeostasis via phosphorylation of the pyruvate dehydrogenase subunits PDHA1 and PDHA2. This inhibits pyruvate dehydrogenase activity, and thereby regulates metabolite flux through the tricarboxylic acid cycle, down-regulates aerobic respiration and inhibits the formation of acetyl-coenzyme A from pyruvate. Plays an important role in cellular responses to hypoxia and is important for cell proliferation under hypoxia. Protects cells against apoptosis in response to hypoxia and oxidative stress.

PTMs:

Phosphorylated by constitutively activated ABL1, FGFR1, FLT3 and JAK2 (in vitro), and this may also occur in cancer cells that express constitutively activated ABL1, FGFR1, FLT3 and JAK2. Phosphorylation at Tyr-243 and Tyr-244 strongly increases kinase activity, while phosphorylation at Tyr-136 has a lesser effect.

Subcellular Location:

Mitochondrion matrix.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed predominantly in the heart. Detected at lower levels in liver, skeletal muscle and pancreas.

Family&Domains:

Belongs to the PDK/BCKDK protein kinase family.

Research Fields

· Environmental Information Processing > Signal transduction > HIF-1 signaling pathway.   (View pathway)

· Human Diseases > Cancers: Overview > Central carbon metabolism in cancer.   (View pathway)

· Organismal Systems > Development > Axon guidance.   (View pathway)

References

1). Thread-structural microneedles loaded with engineered exosomes for annulus fibrosus repair by regulating mitophagy recovery and extracellular matrix homeostasis. Bioactive materials, 2024 (PubMed: 38515611) [IF=18.9]

2). Pimozide inhibits the growth of breast cancer cells by alleviating the Warburg effect through the P53 signaling pathway. BIOMEDICINE & PHARMACOTHERAPY, 2022 (PubMed: 35658233) [IF=6.9]

Application: WB    Species: Human    Sample: MCF-7 cells

Fig. 3. Pimozide inhibits PKM2 protein and mRNA in both MCF-7 and MDA-MB-231 cells in vitro. (A-B) Cells were treated with the indicated concentrations of Pimozide for 24 h, and the protein expression of glycolytic enzymes in MCF-7(A) and MDA-MB-231(B) cells were determined by Western blot analysis (left panel). Densitometry analysis was performed to assess the glycolytic enzymes protein expression (normalized to β-actin expression), PKM2 decreased significantly compared with untreated cells (right panel). (C-D) The mRNA expression of PKM2 in MCF-7(C) and MDA-MB-231(D) cells untreated or treated with Pimozide was determined by qRT-PCR. GAPDH was used as a control. Data represent mean ± SD from three biological replicates (*p < 0.05, **p < 0.01).

3). A simplified herbal decoction attenuates myocardial infarction by regulating macrophage metabolic reprogramming and phenotypic differentiation via modulation of the HIF-1α/PDK1 axis. Chinese medicine, 2024 (PubMed: 38816815) [IF=5.3]

Application: WB    Species: Mouse    Sample:

Fig. 6 NXK modulates the HIF-1α/PDK1 axis. A–C Representative WB images and qualified protein expression levels of cardiac HIF-1α and PDK1 (n ≥ 3). D–G The mRNA expression level of cardiac LDHA, HIF-1α, PDK1, and PDH were detected by qPCR (n ≥ 4). H PDH activity was detected by an Elisa kit and analyzed following instructions (n = 3). I–L The mRNA expression level of cellular LDHA, HIF-1α, PDK1, and PDH were detected by qPCR (n ≥ 3). Values showed as means ± SD, *P 

4). Lactate accumulation induced by Akt2-PDK1 signaling promotes pulmonary fibrosis. FASEB journal : official publication of the Federation of American Societies for Experimental Biology, 2024 (PubMed: 38226859) [IF=4.4]

5). Glycolysis inhibition and AMPK activation: a critical role of CTRP1 deficiency in the treatment of hypoxia-induced pulmonary hypertension. Experimental cell research, 2025 (PubMed: 41285236) [IF=3.3]

6). Identification and Immune Landscape Analysis of Fatty Acid Metabolism-related Genes Associated with Rheumatoid Arthritis. International journal of medical sciences, 2026 (PubMed: 41583523) [IF=3.2]

7). Sevoflurane preconditioning attenuates hypoxia/reoxygenation injury of H9c2 cardiomyocytes by activation of the HIF-1/PDK-1 pathway. PeerJ, 2023 (PubMed: 33391885) [IF=2.3]

Application: WB    Species: Rat    Sample: H9c2 cardiomyocytes

Figure 5 SPC upregulate the protein expression of HIF-1a and PDK-1. (A) Western blot image of HIF-1a protein. (B) Western blot image of PDK-1 protein. (C) HIF-1a protein expression. (D) PDK-1 protein expression. Protein content was normalized to GAPDH. Data represent mean ± SD (n = 3/group). *P < 0.05 vs Con, #P < 0.05 vs H/R, &P < 0.05 vs SPC.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.