C1QB Antibody - #DF3958
Product: | C1QB Antibody |
Catalog: | DF3958 |
Description: | Rabbit polyclonal antibody to C1QB |
Application: | WB IF/ICC |
Reactivity: | Human |
Prediction: | Pig, Bovine, Horse, Sheep, Dog, Chicken |
Mol.Wt.: | 28 KD; 27kD(Calculated). |
Uniprot: | P02746 |
RRID: | AB_2836311 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3958, RRID:AB_2836311.
Fold/Unfold
C1qb; C1QB_HUMAN; Complement C1q subcomponent subunit B; Complement component 1 q subcomponent B chain; Complement component 1 q subcomponent beta polypeptide; Complement component C1q B chain; Complement subcomponent C1q chain B;
Immunogens
- P02746 C1QB_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P02746 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K77 | Methylation | Uniprot | |
K88 | Methylation | Uniprot | |
K92 | Methylation | Uniprot | |
S125 | Phosphorylation | Uniprot | |
T127 | Phosphorylation | Uniprot | |
T129 | Phosphorylation | Uniprot | |
Y168 | Phosphorylation | Uniprot |
Research Backgrounds
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Hydroxylated on lysine and proline residues. Hydroxylated lysine residues can be glycosylated. Human C1Q contains up to 68.3 hydroxylysine-galactosylglucose residues and up to 2.5 hydroxylysine-galactose per molecule. Total percentage hydroxylysine residues glycosylated is 86.4%.
Secreted.
C1 is a calcium-dependent trimolecular complex of C1q, c1r and C1s in the molar ration of 1:2:2. C1q subcomponent is composed of nine subunits, six of which are disulfide-linked dimers of the A and B chains, and three of which are disulfide-linked dimers of the C chain.
Research Fields
· Human Diseases > Neurodegenerative diseases > Prion diseases.
· Human Diseases > Infectious diseases: Bacterial > Pertussis.
· Human Diseases > Infectious diseases: Parasitic > Chagas disease (American trypanosomiasis).
· Human Diseases > Infectious diseases: Bacterial > Staphylococcus aureus infection.
· Human Diseases > Immune diseases > Systemic lupus erythematosus.
· Organismal Systems > Immune system > Complement and coagulation cascades. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.