Product: COMT Antibody
Catalog: DF3905
Description: Rabbit polyclonal antibody to COMT
Application: WB IHC IF/ICC
Reactivity: Human, Mouse
Prediction: Bovine, Horse, Rabbit, Dog
Mol.Wt.: 30 KD; 30kD(Calculated).
Uniprot: P21964
RRID: AB_2836258

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:1000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Prediction:
Bovine(82%), Horse(82%), Rabbit(80%), Dog(91%)
Clonality:
Polyclonal
Specificity:
COMT Antibody detects endogenous levels of total COMT.
RRID:
AB_2836258
Cite Format: Affinity Biosciences Cat# DF3905, RRID:AB_2836258.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Catechol O methyltransferase; Catechol O-methyltransferase; COMT; COMT_HUMAN; EC 2.1.1.6;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P21964 COMT_HUMAN:

Brain, liver, placenta, lymphocytes and erythrocytes.

Sequence:
MPEAPPLLLAAVLLGLVLLVVLLLLLRHWGWGLCLIGWNEFILQPIHNLLMGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Dog
91
Horse
82
Bovine
82
Rabbit
80
Chicken
73
Xenopus
60
Pig
0
Sheep
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P21964 As Substrate

Site PTM Type Enzyme
T81 Phosphorylation
Y82 Phosphorylation
K86 Ubiquitination
K95 Ubiquitination
K98 Ubiquitination
S131 Phosphorylation
C145 S-Nitrosylation
K159 Ubiquitination
K177 Ubiquitination
K178 Ubiquitination
K179 Ubiquitination
Y180 Phosphorylation
K194 Ubiquitination
K212 Ubiquitination
Y244 Phosphorylation
K259 Ubiquitination
Y262 Phosphorylation
K263 Ubiquitination
S267 Phosphorylation

Research Backgrounds

Function:

Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol.

PTMs:

The N-terminus is blocked.

Subcellular Location:

Cytoplasm.

Cell membrane>Single-pass type II membrane protein>Extracellular side.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Brain, liver, placenta, lymphocytes and erythrocytes.

Family&Domains:

Belongs to the class I-like SAM-binding methyltransferase superfamily. Cation-dependent O-methyltransferase family.

Research Fields

· Metabolism > Lipid metabolism > Steroid hormone biosynthesis.

· Metabolism > Amino acid metabolism > Tyrosine metabolism.

· Metabolism > Global and overview maps > Metabolic pathways.

· Organismal Systems > Nervous system > Dopaminergic synapse.

References

1). Bai L et al. m6A demethylase FTO regulates dopaminergic neurotransmission deficits caused by arsenite. TOXICOLOGICAL SCIENCES 2018 Jun 29 (PubMed: 29982692) [IF=3.8]

Application: WB    Species: mouse    Sample: cerebral cortices

Figure 6| Arsenite exposure results in the dopaminergic transmission deficits in mice.After treating of mice with 0.5 mg/L, 5 mg/L and 50 mg/L arsenite for 6 months, the cerebral cortices of mice were collected and lysed for western blot analysis. The protein expressions of key regulators in dopamine synthesis (tyrosine hydroxylase,TH), transport (dopamine transporter, DAT),decompose (catecholamine-O-methyltransferase, COMT) as well as the dopamine receptors on the post-synaptic membrane (DRD1, DRD2, DRD3, DRD4 and DRD5) were detected. (A) Representative images of TH, DAT and COMT in western blot.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.