MFNG Antibody - #DF3837
| Product: | MFNG Antibody |
| Catalog: | DF3837 |
| Description: | Rabbit polyclonal antibody to MFNG |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Dog |
| Mol.Wt.: | 38 KD; 36kD(Calculated). |
| Uniprot: | O00587 |
| RRID: | AB_2836194 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3837, RRID:AB_2836194.
Fold/Unfold
3-N-acetylglucosaminyltransferase manic fringe; Beta-1; Beta-1,3-N-acetylglucosaminyltransferase manic fringe; MFNG; MFNG_HUMAN; O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase;
Immunogens
- O00587 MFNG_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MQCRLPRGLAGALLTLLCMGLLCLRYHLNLSPQRVQGTPELSQPNPGPPKLQLHDVFIAVKTTRAFHRLRLELLLDTWVSRTREQTFVFTDSPDKGLQERLGSHLVVTNCSAEHSHPALSCKMAAEFDTFLASGLRWFCHVDDDNYVNPRALLQLLRAFPLARDVYVGRPSLNRPIHASEPQPHNRTRLVQFWFATGGAGFCINRKLALKMAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETLQLLRTAQLPEQVTLSYGVFEGKLNVIKLQGPFSPEEDPSRFRSLHCLLYPDTPWCPQLGAR
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O00587 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T63 | Phosphorylation | Uniprot | |
| K210 | Ubiquitination | Uniprot | |
| K242 | Ubiquitination | Uniprot |
Research Backgrounds
Glycosyltransferase that initiates the elongation of O-linked fucose residues attached to EGF-like repeats in the extracellular domain of Notch molecules. Modulates NOTCH1 activity by modifying O-fucose residues at specific EGF-like domains resulting in inhibition of NOTCH1 activation by JAG1 and enhancement of NOTCH1 activation by DLL1 via an increase in its binding to DLL1 (By similarity).
Golgi apparatus membrane>Single-pass type II membrane protein.
Belongs to the glycosyltransferase 31 family.
Research Fields
· Environmental Information Processing > Signal transduction > Notch signaling pathway. (View pathway)
· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.
· Metabolism > Glycan biosynthesis and metabolism > Other types of O-glycan biosynthesis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.