Histone H2AZ Antibody - #DF3083
Product: | Histone H2AZ Antibody |
Catalog: | DF3083 |
Description: | Rabbit polyclonal antibody to Histone H2AZ |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Bovine, Sheep, Dog, Chicken, Xenopus |
Mol.Wt.: | 13 KD; 14kD(Calculated). |
Uniprot: | P0C0S5 |
RRID: | AB_2835466 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3083, RRID:AB_2835466.
Fold/Unfold
H2A histone family member Z; H2A.z; H2A/z; H2afz; H2AZ; H2AZ_HUMAN; Histone H2A.Z; MGC117173;
Immunogens
- P0C0S5 H2AZ_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P0C0S5 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K5 | Acetylation | Uniprot | |
K5 | Methylation | Uniprot | |
K8 | Acetylation | Uniprot | |
K8 | Methylation | Uniprot | |
K12 | Acetylation | Uniprot | |
K14 | Acetylation | Uniprot | |
K121 | Ubiquitination | Uniprot | |
K122 | Ubiquitination | Uniprot |
Research Backgrounds
Variant histone H2A which replaces conventional H2A in a subset of nucleosomes. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. May be involved in the formation of constitutive heterochromatin. May be required for chromosome segregation during cell division.
Monoubiquitination of Lys-122 gives a specific tag for epigenetic transcriptional repression.
Acetylated on Lys-5, Lys-8, Lys-12 and Lys-14 by KAT2A; KAT2A is recruited by the XPC complex in absence of DNA damage. Acetylated on Lys-5, Lys-8 and Lys-12 during interphase; acetylation disappears at mitosis (By similarity).
Monomethylated on Lys-5 and Lys-8 by SETD6. SETD6 predominantly methylates Lys-8, lys-5 being a possible secondary site.
Not phosphorylated.
Nucleus. Chromosome.
The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA. H2A or its variant H2AZ1 forms a heterodimer with H2B. H2AZ1 interacts with INCENP (By similarity). Interacts (via M6 cassette) with ANP32E; leading to removal of H2A.Z/H2AZ1 from the nucleosome. Heterodimer H2BC11 and H2AZ1 interacts with VPS72 (via N-terminal domain). Interacts with PWWP2A. Interacts with FH (when phosphorylated by PRKDC).
Belongs to the histone H2A family.
Research Fields
· Cellular Processes > Cell growth and death > Necroptosis. (View pathway)
· Human Diseases > Substance dependence > Alcoholism.
· Human Diseases > Immune diseases > Systemic lupus erythematosus.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.