Product: E2F-2 Antibody
Catalog: AF4100
Description: Rabbit polyclonal antibody to E2F-2
Application: WB IHC IF/ICC
Cited expt.: WB, IF/ICC
Reactivity: Human, Mouse
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 45kd(Observed); 48kD(Calculated).
Uniprot: Q14209
RRID: AB_2835358

View similar products>>

   Size Price Inventory
 50ul $250 In stock
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:1000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(90%), Dog(100%)
Clonality:
Polyclonal
Specificity:
E2F-2 Antibody detects endogenous levels of total E2F-2.
RRID:
AB_2835358
Cite Format: Affinity Biosciences Cat# AF4100, RRID:AB_2835358.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Supplied at 1.0mg/mL in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

dE2F2; E2F transcription factor 2; E2F-2; E2F2; E2F2_HUMAN; Transcription factor E2F2;

Immunogens

Immunogen:

A synthesized peptide derived from human E2F-2, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
Q14209 E2F2_HUMAN:

Highest level of expression is found in placenta, low levels are found in lung. Found as well in many immortalized cell lines derived from tumor samples.

Description:
Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DRTF1/E2F complex functions in the control of cell-cycle progression from g1 to s phase. E2F-2 binds specifically to RB1 protein, in a cell-cycle dependent manner.
Sequence:
MLQGPRALASAAGQTPKVVPAMSPTELWPSGLSSPQLCPATATYYTPLYPQTAPPAAAPGTCLDATPHGPEGQVVRCLPAGRLPAKRKLDLEGIGRPVVPEFPTPKGKCIRVDGLPSPKTPKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQLIRKKAKNNIQWVGRGMFEDPTRPGKQQQLGQELKELMNTEQALDQLIQSCSLSFKHLTEDKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRTEDNLQIYLKSTQGPIEVYLCPEEVQEPDSPSEEPLPSTSTLCPSPDSAQPSSSTDPSIMEPTASSVPAPAPTPQQAPPPPSLVPLEATDSLLELPHPLLQQTEDQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGEGISDLFDSYDLGDLLIN

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Rabbit
90
Chicken
70
Xenopus
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DRTF1/E2F complex functions in the control of cell-cycle progression from g1 to s phase. E2F2 binds specifically to RB1 in a cell-cycle dependent manner.

PTMs:

Phosphorylated by CDK2 and cyclin A-CDK2 in the S-phase.

Subcellular Location:

Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Highest level of expression is found in placenta, low levels are found in lung. Found as well in many immortalized cell lines derived from tumor samples.

Family&Domains:

Belongs to the E2F/DP family.

Research Fields

· Cellular Processes > Cell growth and death > Cell cycle.   (View pathway)

· Cellular Processes > Cell growth and death > Cellular senescence.   (View pathway)

· Human Diseases > Drug resistance: Antineoplastic > Endocrine resistance.

· Human Diseases > Infectious diseases: Viral > Hepatitis B.

· Human Diseases > Infectious diseases: Viral > HTLV-I infection.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > MicroRNAs in cancer.

· Human Diseases > Cancers: Specific types > Pancreatic cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Glioma.   (View pathway)

· Human Diseases > Cancers: Specific types > Prostate cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Melanoma.   (View pathway)

· Human Diseases > Cancers: Specific types > Bladder cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Chronic myeloid leukemia.   (View pathway)

· Human Diseases > Cancers: Specific types > Small cell lung cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Non-small cell lung cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Breast cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma.   (View pathway)

· Human Diseases > Cancers: Specific types > Gastric cancer.   (View pathway)

References

1). Single cell epigenomic and transcriptomic analysis uncovers potential transcription factors regulating mitotic/meiotic switch. Cell death & disease, 2023 (PubMed: 36797258) [IF=8.1]

Application: IF/ICC    Species: Mouse    Sample:

Fig. 7: The potential mechanism of TCFL5 in mitotic/meiotic switch. A The model shows the potential downstream factors regulated by TCFL5 in the mitotic/meiotic switch. B Effect of siTcfl5 on TCLF5 expression; n ≥ 3; Compared to siNC group, ** means p value 

Application: WB    Species: Mouse    Sample:

Fig. 7: The potential mechanism of TCFL5 in mitotic/meiotic switch. A The model shows the potential downstream factors regulated by TCFL5 in the mitotic/meiotic switch. B Effect of siTcfl5 on TCLF5 expression; n ≥ 3; Compared to siNC group, ** means p value 

2). Morinda officinalis oligosaccharides mitigate chronic mild stress-induced inflammation and depression-like behaviour by deactivating the MyD88/PI3K pathway via E2F2. Frontiers in pharmacology, 2022 (PubMed: 36052143) [IF=5.6]

Application: WB    Species: Mouse    Sample: hippocampus

FIGURE 4. Effects of MOs on E2F2-regulated MyD88/PI3K pathway in the hippocampus. (A–B) qRT-PCR analysis of gene expression of E2F2 and MyD88 in hippocampus tissues. (C–H) Immunoblot analysis of E2F2, MyD88, p-PI3K, p-AKT and p-NF-κB p65 in hippocampus tissues. Data are expressed as means ± SD (n = 3). ##p < 0.01 vs. control; *p < 0.05; **p < 0.01 vs. Mod.

3). Targeting diacylglycerol kinase α impairs lung tumorigenesis by inhibiting cyclin D3. Thoracic cancer, 2023 (PubMed: 36965165) [IF=2.3]

Application: WB    Species: human    Sample: A549 and AH1299 cells

FIGURE 5 DGKA silencing downregulates the expression of CCND3. (a) Volcano plot showing differentially expressed genes in DGKA-depleted vs. scramble siRNA-transfected A549 cells. (b) Venn diagram showing the number of genes in each indicated set. (c) Enrichment of differentially expressed genes in the pathways is illustrated in a Kyoto Encyclopedia of Genes and Genomes enrichment bubble chart. Y-axis represents the pathways, and the X-axis represents rich ratio. (d) Clustering heatmap of eight deregulated genes affected by loss of DGKA. (e) A549 and H1299 cells were transfected with the indicated siRNAs. After 48 h, the cells were harvested, and the levels of indicated mRNAs were measured by real-time qPCR. ***p 

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.