Product: LAT Antibody
Catalog: AF2659
Description: Rabbit polyclonal antibody to LAT
Application: WB
Reactivity: Human, Mouse
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 28kDa; 28kD(Calculated).
Uniprot: O43561

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Polyclonal
Specificity:
LAT Antibody detects endogenous levels of total LAT.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

36 kDa phospho tyrosine adapter protein; 36 kDa phospho-tyrosine adapter protein; 36 kDa phospho-tyrosine adaptor protein; LAT 1; lat; LAT_HUMAN; LAT1; Linker for activation of T cells; Linker for activation of T cells family member 1; linker for activation of T cells, transmembrane adaptor; Linker for activation of T-cells family member 1; p36 38; p36-38; pp36;

Immunogens

Immunogen:

A synthesized peptide derived from human LAT, corresponding to a region within the C-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
O43561 LAT_HUMAN:

Expressed in thymus, T-cells, NK cells, mast cells and, at lower levels, in spleen. Present in T-cells but not B-cells (at protein level).

Sequence:
MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEGASGIRGAQAGWGVWGPSWTRLTPVSLPPEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN

PTMs - O43561 As Substrate

Site PTM Type Enzyme
S35 Phosphorylation
Y36 Phosphorylation
S38 Phosphorylation
T39 Phosphorylation
S40 Phosphorylation
S41 Phosphorylation
S43 Phosphorylation
Y45 Phosphorylation
K52 Ubiquitination
Y64 Phosphorylation
T68 Phosphorylation
Y70 Phosphorylation
S74 Phosphorylation
S84 Phosphorylation
S91 Phosphorylation
T94 Phosphorylation
S96 Phosphorylation
S97 Phosphorylation
S101 Phosphorylation
S106 Phosphorylation
S109 Phosphorylation
Y110 Phosphorylation
S131 Phosphorylation
Y156 Phosphorylation P43403 (ZAP70)
Y161 Phosphorylation P43403 (ZAP70)
S183 Phosphorylation
T184 Phosphorylation P27361 (MAPK3) , P45983 (MAPK8)
Y200 Phosphorylation P06239 (LCK) , P43403 (ZAP70) , Q08881 (ITK) , P06241 (FYN)
S206 Phosphorylation
S213 Phosphorylation
S217 Phosphorylation
Y220 Phosphorylation P06241 (FYN) , P43403 (ZAP70) , P06239 (LCK) , Q08881 (ITK)
S224 Phosphorylation
S240 Phosphorylation
S241 Phosphorylation
Y255 Phosphorylation P43403 (ZAP70)

Research Backgrounds

Function:

Required for TCR (T-cell antigen receptor)- and pre-TCR-mediated signaling, both in mature T-cells and during their development. Involved in FCGR3 (low affinity immunoglobulin gamma Fc region receptor III)-mediated signaling in natural killer cells and FCER1 (high affinity immunoglobulin epsilon receptor)-mediated signaling in mast cells. Couples activation of these receptors and their associated kinases with distal intracellular events such as mobilization of intracellular calcium stores, PKC activation, MAPK activation or cytoskeletal reorganization through the recruitment of PLCG1, GRB2, GRAP2, and other signaling molecules.

PTMs:

Phosphorylated on tyrosines by ZAP70 upon TCR activation, or by SYK upon other immunoreceptor activation; which leads to the recruitment of multiple signaling molecules. Is one of the most prominently tyrosine-phosphorylated proteins detected following TCR engagement. May be dephosphorylated by PTPRJ. Phosphorylated by ITK leading to the recruitment of VAV1 to LAT-containing complexes.

Palmitoylation of Cys-26 and Cys-29 is required for raft targeting and efficient phosphorylation.

Subcellular Location:

Cell membrane>Single-pass type III membrane protein.
Note: Present in lipid rafts.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in thymus, T-cells, NK cells, mast cells and, at lower levels, in spleen. Present in T-cells but not B-cells (at protein level).

Subunit Structure:

When phosphorylated, interacts directly with the PIK3R1 subunit of phosphoinositide 3-kinase and the SH2 domains of GRB2, GRAP, GRAP2, PLCG1 and PLCG2. Interacts indirectly with CBL, SOS, VAV, and LCP2. Interacts with SHB, SKAP2 and CLNK (By similarity). Interacts with FCGR1A. Interacts with GRB2, PLCG1 and THEMIS upon TCR activation in thymocytes (By similarity).

Research Fields

· Environmental Information Processing > Signal transduction > Ras signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Rap1 signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > NF-kappa B signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Natural killer cell mediated cytotoxicity.   (View pathway)

· Organismal Systems > Immune system > Th1 and Th2 cell differentiation.   (View pathway)

· Organismal Systems > Immune system > Th17 cell differentiation.   (View pathway)

· Organismal Systems > Immune system > T cell receptor signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Fc epsilon RI signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Fc gamma R-mediated phagocytosis.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.