Product: VDAC3 Antibody
Catalog: DF13768
Description: Rabbit polyclonal antibody to VDAC3
Application: WB IHC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 30kD; 31kD(Calculated).
Uniprot: Q9Y277

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IHC 1:50-1:200, WB 1:500-1:2000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
VDAC3 Antibody detects endogenous levels of total VDAC3.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

hVDAC3; mVDAC3; Outer mitochondrial membrane protein porin 3; voltage dependent anion channel 3;

Immunogens

Immunogen:

A synthesized peptide derived from Human VDAC3.

Uniprot:
Gene(ID):
Expression:
Q9Y277 VDAC3_HUMAN:

Widely expressed. Highest in testis.

Sequence:
MCNTPTYCDLGKAAKDVFNKGYGFGMVKIDLKTKSCSGVEFSTSGHAYTDTGKASGNLETKYKVCNYGLTFTQKWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKRDCFSVGSNVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAKSKLSQNNFALGYKAADFQLHTHVNDGTEFGGSIYQKVNEKIETSINLAWTAGSNNTRFGIAAKYMLDCRTSLSAKVNNASLIGLGYTQTLRPGVKLTLSALIDGKNFSAGGHKVGLGFELEA

PTMs - Q9Y277 As Substrate

Site PTM Type Enzyme
Ubiquitination
C2 Acetylation
T4 Phosphorylation
T6 Phosphorylation
Y7 Phosphorylation
K12 Acetylation
K12 Ubiquitination
K15 Acetylation
K15 Ubiquitination
K20 Acetylation
K20 Ubiquitination
Y22 Phosphorylation
K28 Acetylation
K28 Ubiquitination
C36 S-Nitrosylation
S44 Phosphorylation
Y48 Phosphorylation
T49 Phosphorylation
K53 Ubiquitination
K61 Acetylation
K61 Ubiquitination
K63 Acetylation
K63 Ubiquitination
C65 S-Nitrosylation
Y67 Phosphorylation
T70 Phosphorylation
K90 Acetylation
K90 Ubiquitination
K96 Acetylation
T107 Phosphorylation
K109 Acetylation
K109 Ubiquitination
K110 Acetylation
K110 Ubiquitination
K113 Acetylation
K115 Acetylation
K119 Acetylation
K163 Acetylation
K163 Ubiquitination
Y173 Phosphorylation
K174 Acetylation
Y195 Phosphorylation
K197 Ubiquitination
K224 Acetylation
Y247 Phosphorylation
T250 Phosphorylation
S260 Phosphorylation
K266 Acetylation
K266 Ubiquitination
K274 Ubiquitination

Research Backgrounds

Function:

Forms a channel through the mitochondrial outer membrane that allows diffusion of small hydrophilic molecules.

PTMs:

Ubiquitinated by PRKN during mitophagy, leading to its degradation and enhancement of mitophagy. Deubiquitinated by USP30.

Subcellular Location:

Mitochondrion outer membrane.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Widely expressed. Highest in testis.

Family&Domains:

Consists mainly of a membrane-spanning beta-barrel formed by 19 beta-strands.

Belongs to the eukaryotic mitochondrial porin family.

Research Fields

· Cellular Processes > Cell growth and death > Ferroptosis.   (View pathway)

· Cellular Processes > Cell growth and death > Necroptosis.   (View pathway)

· Cellular Processes > Cell growth and death > Cellular senescence.   (View pathway)

· Environmental Information Processing > Signal transduction > Calcium signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > cGMP-PKG signaling pathway.   (View pathway)

· Human Diseases > Neurodegenerative diseases > Parkinson's disease.

· Human Diseases > Neurodegenerative diseases > Huntington's disease.

· Human Diseases > Infectious diseases: Viral > Hepatitis B.

· Human Diseases > Infectious diseases: Viral > HTLV-I infection.

· Human Diseases > Cancers: Overview > Viral carcinogenesis.

· Organismal Systems > Immune system > NOD-like receptor signaling pathway.   (View pathway)

· Organismal Systems > Digestive system > Cholesterol metabolism.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.