Phospho-CD40 (Thr254) Antibody - #AF3693

(1)  
Product: Phospho-CD40 (Thr254) Antibody
Catalog: AF3693
Description: Rabbit polyclonal antibody to Phospho-CD40 (Thr254)
Application: WB
Reactivity: Human, Mouse
Mol.Wt.: 31kD(Calculated).
Uniprot: P25942
RRID: AB_2847007

View similar products>>

   Size Price Inventory
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Polyclonal
Specificity:
Phospho-CD40 (Thr254) Antibody detects endogenous levels of CD40 only when phosphorylated at Thr254.
RRID:
AB_2847007
Cite Format: Affinity Biosciences Cat# AF3693, RRID:AB_2847007.
Conjugate:
Unconjugated.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

AI326936; B cell associated molecule CD40; B cell surface antigen CD40; B cell-associated molecule; B-cell surface antigen CD40; Bp50; CD 40; CD40; CD40 antigen (TNF receptor superfamily member 5); CD40 antigen; CD40 molecule; CD40 molecule, TNF receptor superfamily member 5; CD40 protein; CD40 type II isoform; CD40L receptor; CDw40; GP39; HIGM1; IGM; IMD3; MGC9013; Nerve growth factor receptor related B lymphocyte activation molecule; OTTHUMP00000031699; OTTHUMP00000031700; p50; T-BAM; TBAM; TNF receptor superfamily member 5; TNFRSF5; TNR5_HUMAN; TRAP; Tumor necrosis factor receptor superfamily , member 5; Tumor necrosis factor receptor superfamily member 5; Tumor necrosis factor receptor superfamily member 5 precursor; Tumor necrosis factor receptor superfamily, member 5, isoform CRA_a;

Immunogens

Immunogen:

A synthesized peptide derived from human CD40 around the phosphorylation site of Thr254.

Uniprot:

P25942(TNR5_HUMAN) >>Visit HPA database.

Gene(ID):
CD40(958)
Expression:
P25942 TNR5_HUMAN:

B-cells and in primary carcinomas.

Sequence:
MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ

PTMs - P25942 As Substrate

Site PTM Type Enzyme
T223 Phosphorylation
T254 Phosphorylation
S272 Phosphorylation

Research Backgrounds

Function:

Receptor for TNFSF5/CD40LG. Transduces TRAF6- and MAP3K8-mediated signals that activate ERK in macrophages and B cells, leading to induction of immunoglobulin secretion (By similarity).

Subcellular Location:

Cell membrane>Single-pass type I membrane protein.

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

B-cells and in primary carcinomas.

Subunit Structure:

Monomer and homodimer. The variant form found in the bladder carcinoma cell line Hu549 does not form homodimers. Interacts with TRAF1, TRAF2, TRAF3, TRAF5 and TRAF6. Interacts with TRAF6 and MAP3K8; the interaction is required for ERK activation.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Environmental Information Processing > Signal transduction > NF-kappa B signaling pathway.   (View pathway)

· Environmental Information Processing > Signaling molecules and interaction > Cell adhesion molecules (CAMs).   (View pathway)

· Human Diseases > Infectious diseases: Parasitic > Malaria.

· Human Diseases > Infectious diseases: Parasitic > Toxoplasmosis.

· Human Diseases > Infectious diseases: Viral > HTLV-I infection.

· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.

· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.

· Human Diseases > Immune diseases > Asthma.

· Human Diseases > Immune diseases > Autoimmune thyroid disease.

· Human Diseases > Immune diseases > Systemic lupus erythematosus.

· Human Diseases > Immune diseases > Allograft rejection.

· Human Diseases > Immune diseases > Primary immunodeficiency.

· Human Diseases > Cardiovascular diseases > Viral myocarditis.

· Organismal Systems > Immune system > Toll-like receptor signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Intestinal immune network for IgA production.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.