Phospho-4E-BP1 (Ser65) Antibody | Affinity Biosciences

Product:	Phospho-4E-BP1 (Ser65) Antibody
Catalog:	AF3601
Description:	Rabbit polyclonal antibody to Phospho-4E-BP1 (Ser65)
Application:	ELISA(peptide)
Reactivity:	Human, Mouse, Rat
Mol.Wt.:	13kD(Calculated).
Uniprot:	Q13541
RRID:	AB_2846915

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
100ul	$350	In stock
200ul	$450	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human,Mouse,Rat

Clonality:

Polyclonal

Specificity:

Phospho-4E-BP1 (Ser65) Antibody detects endogenous levels of 4E-BP1 only when phosphorylated at Ser65.

RRID:

AB_2846915
Cite Format: Affinity Biosciences Cat# AF3601, RRID:AB_2846915.

Conjugate:

Unconjugated.

Purification:

The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

4E-BP1; 4EBP1; 4EBP1_HUMAN; BP 1; eIF4E binding protein 1; eIF4E-binding protein 1; Eif4ebp1; Eukaryotic translation initiation factor 4E-binding protein 1; PHAS-I; PHASI; Phosphorylated heat- and acid-stable protein regulated by insulin 1;

Immunogens

Immunogen:

A synthesized peptide derived from human 4E-BP1 around the phosphorylation site of Ser65.

Uniprot:

Q13541(4EBP1_HUMAN) >>Visit HPA database.

Gene(ID):

EIF4EBP1(1978)

Sequence:

Q13541 4EBP1_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI

PTMs - Q13541 As Substrate

Q13541

Site	PTM Type	Enzyme	Source
S2	Acetylation		Uniprot
S2	Phosphorylation		Uniprot
S5	Phosphorylation		Uniprot
S6	Phosphorylation		Uniprot
S8	Phosphorylation	Q13315 (ATM)	Uniprot
T10	Phosphorylation		Uniprot
S12	Phosphorylation		Uniprot
Y34	Phosphorylation		Uniprot
S35	Phosphorylation		Uniprot
T36	Phosphorylation	P51449 (RORC) , O75582 (RPS6KA5) , P31751 (AKT2) , P42345 (MTOR)	Uniprot
T37	Phosphorylation	P49841 (GSK3B) , Q16539 (MAPK14) , P31749 (AKT1) , P42345 (MTOR) , P06493 (CDK1) , P28482 (MAPK1) , Q5S007 (LRRK2)	Uniprot
T41	Phosphorylation	P42345 (MTOR) , P49674 (CSNK1E)	Uniprot
S44	Phosphorylation	P42345 (MTOR)	Uniprot
T45	Phosphorylation	O75582 (RPS6KA5) , P28482 (MAPK1) , P42345 (MTOR) , P31751 (AKT2) , P51449 (RORC)	Uniprot
T46	Phosphorylation	P06493 (CDK1) , Q5S007 (LRRK2) , Q16539 (MAPK14) , P42345 (MTOR) , P31749 (AKT1) , P28482 (MAPK1) , P49841 (GSK3B)	Uniprot
T50	Phosphorylation	P49674 (CSNK1E)	Uniprot
Y54	Phosphorylation		Uniprot
K57	Ubiquitination		Uniprot
C62	S-Nitrosylation		Uniprot
R63	Methylation		Uniprot
S65	Phosphorylation	P27361 (MAPK3) , P42345 (MTOR) , P28482 (MAPK1) , O75582 (RPS6KA5) , Q8TAI7 (RHEBL1) , P31749 (AKT1) , Q92630 (DYRK2) , Q9P1W9 (PIM2) , P06493 (CDK1) , Q16539 (MAPK14)	Uniprot
T68	Phosphorylation		Uniprot
K69	Ubiquitination		Uniprot
T70	Phosphorylation	P28482 (MAPK1) , P06493 (CDK1) , Q16539 (MAPK14) , P42345 (MTOR) , P41279 (MAP3K8)	Uniprot
T77	Phosphorylation		Uniprot
T82	Phosphorylation		Uniprot
S83	Phosphorylation	P42345 (MTOR) , P06493 (CDK1) , P28482 (MAPK1)	Uniprot
S85	Phosphorylation		Uniprot
S86	Phosphorylation		Uniprot
S94	Phosphorylation	Q13315 (ATM) , Q13535 (ATR)	Uniprot
S96	Phosphorylation		Uniprot
S101	Phosphorylation	Q92630 (DYRK2) , P42345 (MTOR)	Uniprot
S112	Phosphorylation	P19784 (CSNK2A2) , P68400 (CSNK2A1) , Q13315 (ATM)	Uniprot

Research Backgrounds

Q13541_4EBP1_HUMAN

Function:

Repressor of translation initiation that regulates EIF4E activity by preventing its assembly into the eIF4F complex: hypophosphorylated form competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation. In contrast, hyperphosphorylated form dissociates from EIF4E, allowing interaction between EIF4G1/EIF4G3 and EIF4E, leading to initiation of translation. Mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase and mTORC1 pathways.

PTMs:

Phosphorylated on serine and threonine residues in response to insulin, EGF and PDGF. Phosphorylation at Thr-37, Thr-46, Ser-65 and Thr-70, corresponding to the hyperphosphorylated form, is regulated by mTORC1 and abolishes binding to EIF4E.

Ubiquitinated: when eIF4E levels are low, hypophosphorylated form is ubiquitinated by the BCR(KLHL25) complex, leading to its degradation and serving as a homeostatic mechanism to maintain translation and prevent eIF4E inhibition when eIF4E levels are low. Not ubiquitinated when hyperphosphorylated (at Thr-37, Thr-46, Ser-65 and Thr-70) or associated with eIF4E.

Subunit Structure:

Hypophosphorylated EIF4EBP1 competes with EIF4G1/EIF4G3 to interact with EIF4E; insulin stimulated MAP-kinase (MAPK1 and MAPK3) or mTORC1 phosphorylation of EIF4EBP1 causes dissociation of the complex allowing EIF4G1/EIF4G3 to bind and consequent initiation of translation. Interacts (via TOS motif) with RPTOR; promoting phosphorylation by mTORC1.

Family&Domains:

The TOS motif mediates interaction with RPTOR, leading to promote phosphorylation by mTORC1 complex.

Belongs to the eIF4E-binding protein family.

Research Fields

· Cellular Processes > Cell growth and death > Cellular senescence. (View pathway)

· Environmental Information Processing > Signal transduction > ErbB signaling pathway. (View pathway)

· Environmental Information Processing > Signal transduction > HIF-1 signaling pathway. (View pathway)

· Environmental Information Processing > Signal transduction > mTOR signaling pathway. (View pathway)

· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway. (View pathway)

· Environmental Information Processing > Signal transduction > AMPK signaling pathway. (View pathway)

· Genetic Information Processing > Translation > RNA transport.

· Human Diseases > Drug resistance: Antineoplastic > EGFR tyrosine kinase inhibitor resistance.

· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.

· Human Diseases > Cancers: Specific types > Acute myeloid leukemia. (View pathway)

· Human Diseases > Cancers: Overview > Choline metabolism in cancer. (View pathway)

· Organismal Systems > Aging > Longevity regulating pathway. (View pathway)

· Organismal Systems > Endocrine system > Insulin signaling pathway. (View pathway)

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

Phospho-4E-BP1 (Ser65) Antibody - #AF3601