Histone H2A-Bbd Antibody - #DF13466
Product: | Histone H2A-Bbd Antibody |
Catalog: | DF13466 |
Description: | Rabbit polyclonal antibody to Histone H2A-Bbd |
Application: | WB |
Reactivity: | Human |
Mol.Wt.: | 12kDa; 13kD(Calculated). |
Uniprot: | P0C5Y9 |
RRID: | AB_2846485 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13466, RRID:AB_2846485.
Immunogens
- P0C5Y9 H2AB1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVPELAGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED
PTMs - P0C5Y9 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S11 | Phosphorylation | Uniprot | |
T19 | Phosphorylation | Uniprot |
Research Backgrounds
Atypical histone H2A which can replace conventional H2A in some nucleosomes and is associated with active transcription and mRNA processing. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. Nucleosomes containing this histone are less rigid and organize less DNA than canonical nucleosomes in vivo. They are enriched in actively transcribed genes and associate with the elongating form of RNA polymerase. They associate with spliceosome components and are required for mRNA splicing.
Nucleus. Chromosome.
Note: Associated with the active X chromosome and with autosomes, while it is absent from the inactive X chromosome and excluded from Barr bodies.
Present in mature sperm.
The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. May be incorporated into a proportion of nucleosomes, replacing one or more H2A molecules.
The docking domain is responsible for the weaker heterodimerization with H2B.
Belongs to the histone H2A family.
Research Fields
· Cellular Processes > Cell growth and death > Necroptosis. (View pathway)
· Human Diseases > Substance dependence > Alcoholism.
· Human Diseases > Immune diseases > Systemic lupus erythematosus.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.