Macro H2A.2 Antibody - #DF13465
Product: | Macro H2A.2 Antibody |
Catalog: | DF13465 |
Description: | Rabbit polyclonal antibody to Macro H2A.2 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 40kDa; 40kD(Calculated). |
Uniprot: | Q9P0M6 |
RRID: | AB_2846484 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13465, RRID:AB_2846484.
Fold/Unfold
Core histone macro H2A2.2; Core histone macro-H2A.2; Core histone macroH2A2.2; H2A histone family member Y2; H2AFY2; H2AW_HUMAN; Histone macroH2A2; Macro H2A.2; Macro H2A2; MacroH2A.2; MacroH2A2; mH2A2;
Immunogens
- Q9P0M6 H2AW_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSGRSGKKKMSKLSRSARAGVIFPVGRLMRYLKKGTFKYRISVGAPVYMAAVIEYLAAEILELAGNAARDNKKARIAPRHILLAVANDEELNQLLKGVTIASGGVLPRIHPELLAKKRGTKGKSETILSPPPEKRGRKATSGKKGGKKSKAAKPRTSKKSKPKDSDKEGTSNSTSEDGPGDGFTILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKEFLETVKELRKSQGPLEVAEAAVSQSSGLAAKFVIHCHIPQWGSDKCEEQLEETIKNCLSAAEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLKAISAHFDDSSASSLKNVYFLLFDSESIGIYVQEMAKLDAK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9P0M6 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K12 | Acetylation | Uniprot | |
R27 | Methylation | Uniprot | |
Y31 | Phosphorylation | Uniprot | |
Y55 | Phosphorylation | Uniprot | |
K116 | Ubiquitination | Uniprot | |
K117 | Ubiquitination | Uniprot | |
K123 | Ubiquitination | Uniprot | |
S129 | Phosphorylation | Uniprot | |
S160 | Phosphorylation | Uniprot | |
S165 | Phosphorylation | Uniprot | |
S171 | Phosphorylation | Uniprot | |
S190 | Phosphorylation | Uniprot | |
S198 | Phosphorylation | Uniprot | |
T200 | Phosphorylation | Uniprot | |
K239 | Ubiquitination | Uniprot | |
K246 | Ubiquitination | Uniprot | |
S251 | Phosphorylation | Uniprot | |
S263 | Phosphorylation | Uniprot | |
S266 | Phosphorylation | Uniprot | |
K285 | Acetylation | Uniprot | |
K304 | Acetylation | Uniprot | |
K332 | Ubiquitination | Uniprot | |
S342 | Phosphorylation | Uniprot |
Research Backgrounds
Variant histone H2A which replaces conventional H2A in a subset of nucleosomes where it represses transcription. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. May be involved in stable X chromosome inactivation.
Nucleus. Chromosome.
Note: Enriched in inactive X chromosome chromatin (PubMed:11331621, PubMed:11262398) and in senescence-associated heterochromatin (PubMed:15621527).
The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers.
Research Fields
· Cellular Processes > Cell growth and death > Necroptosis. (View pathway)
· Human Diseases > Substance dependence > Alcoholism.
· Human Diseases > Immune diseases > Systemic lupus erythematosus.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.