APH1a Antibody - #DF13339
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13339, RRID:AB_2846358.
Fold/Unfold
6530402N02Rik; AL138795.3; Anterior Pharynx Defective 1; Anterior pharynx defective 1 homolog A; APH 1A; Aph 1alpha; APH-1a; Aph-1alpha; Aph1a; APH1A gamma secretase subunit; APH1A_HUMAN; CGI 78; CGI78; Gamma secretase subunit APH 1A; Gamma Secretase Subunit APH1a; Gamma-secretase subunit APH-1A; Likely ortholog of C. elegans anterior pharynx defective 1A; Presenilin Stabilization Factor; Presenilin-stabilization factor; PSF; UNQ579/PRO1141;
Immunogens
Widely expressed. Expressed in leukocytes, lung, placenta, small intestine, liver, kidney, spleen thymus, skeletal muscle, heart and brain. Isoform 1 and isoform 2 are nearly expressed at the same level.
- Q96BI3 APH1A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQRSLLCRRQEDSRVMVYSALRIPPED
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q96BI3 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K92 | Ubiquitination | Uniprot | |
| K96 | Ubiquitination | Uniprot | |
| S242 | Phosphorylation | Uniprot | |
| Y256 | Phosphorylation | Uniprot | |
| S257 | Phosphorylation | Uniprot |
Research Backgrounds
Non-catalytic subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (amyloid-beta precursor protein). Required for normal gamma-secretase assembly. The gamma-secretase complex plays a role in Notch and Wnt signaling cascades and regulation of downstream processes via its role in processing key regulatory proteins, and by regulating cytosolic CTNNB1 levels (Probable).
Endoplasmic reticulum membrane>Multi-pass membrane protein. Golgi apparatus>Golgi stack membrane>Multi-pass membrane protein.
Note: Predominantly located in the endoplasmic reticulum and in the cis-Golgi.
Widely expressed. Expressed in leukocytes, lung, placenta, small intestine, liver, kidney, spleen thymus, skeletal muscle, heart and brain. Isoform 1 and isoform 2 are nearly expressed at the same level.
The functional gamma-secretase complex is composed of at least four polypeptides: a presenilin homodimer (PSEN1 or PSEN2), nicastrin (NCSTN), APH1 (APH1A or APH1B) and PSENEN/PEN2.
Belongs to the APH-1 family.
Research Fields
· Environmental Information Processing > Signal transduction > Notch signaling pathway. (View pathway)
· Human Diseases > Neurodegenerative diseases > Alzheimer's disease.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.