DTX4 Antibody - #DF12963
![](/images/pubmed.gif)
Product: | DTX4 Antibody |
Catalog: | DF12963 |
Description: | Rabbit polyclonal antibody to DTX4 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 67 kDa; 67kD(Calculated). |
Uniprot: | Q9Y2E6 |
RRID: | AB_2845924 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12963, RRID:AB_2845924.
Fold/Unfold
Deltex4; Dtx4; DTX4_HUMAN; E3 ubiquitin-protein ligase DTX4; Protein deltex-4; RING finger protein 155; RNF155;
Immunogens
- Q9Y2E6 DTX4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLLASAVVVWEWLNEHGRWRPYSPAVSHHIEAVVRAGPRAGGSVVLGQVDSRLAPYIIDLQSMNQFRQDTGTLRPVRRNYYDPSSAPGKGVVWEWENDNGSWTPYDMEVGITIQHAYEKQHPWIDLTSIGFSYVIDFNTMGQINRQTQRQRRVRRRLDLIYPMVTGTLPKAQSWPVSPGPATSPPMSPCSCPQCVLVMSVKAAVVNGSTGPLQLPVTRKNMPPPGVVKLPPLPGSGAKPLDSTGTIRGPLKTAPSQVIRRQASSMPTGTTMGSPASPPGPNSKTGRVALATLNRTNLQRLAIAQSRVLIASGVPTVPVKNLNGSSPVNPALAGITGILMSAAGLPVCLTRPPKLVLHPPPVSKSEIKSIPGVSNTSRKTTKKQAKKGKTPEEVLKKYLQKVRHPPDEDCTICMERLTAPSGYKGPQPTVKPDLVGKLSRCGHVYHIYCLVAMYNNGNKDGSLQCPTCKTIYGVKTGTQPPGKMEYHLIPHSLPGHPDCKTIRIIYSIPPGIQGPEHPNPGKSFSARGFPRHCYLPDSEKGRKVLKLLLVAWDRRLIFAIGTSSTTGESDTVIWNEVHHKTEFGSNLTGHGYPDANYLDNVLAELAAQGISEDSTAQEKD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9Y2E6 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T243 | Phosphorylation | Uniprot | |
T245 | Phosphorylation | Uniprot | |
T270 | Phosphorylation | Uniprot | |
S311 | Phosphorylation | Uniprot | |
T315 | Phosphorylation | Uniprot | |
S376 | Phosphorylation | Uniprot | |
Y447 | Phosphorylation | Uniprot | |
Y453 | Phosphorylation | Uniprot | |
Y505 | Phosphorylation | Uniprot | |
S506 | Phosphorylation | Uniprot |
Research Backgrounds
Regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations (By similarity). Functions as a ubiquitin ligase protein in vivo, mediating 'Lys48'-linked polyubiquitination and promoting degradation of TBK1, targeting to TBK1 requires interaction with NLRP4.
Cytoplasm.
Interacts with NLRP4.
The WWE domains are thought to mediate some protein-protein interaction, and are frequently found in ubiquitin ligases.
Belongs to the Deltex family.
Research Fields
· Environmental Information Processing > Signal transduction > Notch signaling pathway. (View pathway)
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.