Neutrophil Elastase Antibody - #AF0010

(3)   (7)  
Product: Neutrophil Elastase Antibody
Catalog: AF0010
Description: Rabbit polyclonal antibody to Neutrophil Elastase
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 29 kDa; 29kD(Calculated).
Uniprot: P08246
RRID: AB_2845469

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
Neutrophil Elastase Antibody detects endogenous levels of total Neutrophil Elastase.
RRID:
AB_2845469
Cite Format: Affinity Biosciences Cat# AF0010, RRID:AB_2845469.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Bone marrow serine protease; ELA2; ELANE; Elastase 2; Elastase 2 neutrophil; Elastase neutrophil expressed; Elastase-2; ELNE_HUMAN; GE; Granulocyte derived elastase; HLE; HNE; Human leukocyte elastase; Leukocyte elastase; Medullasin; NE; Neutrophil elastase; PMN E; PMN elastase; Polymorphonuclear elastase; SCN1;

Immunogens

Immunogen:
Uniprot:

P08246(ELNE_HUMAN) >>Visit HPA database.

Gene(ID):
ELANE(1991)
Expression:
P08246 ELNE_HUMAN:

Bone marrow cells. Neutrophil (PubMed:10947984).

Sequence:
MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH

PTMs - P08246 As Substrate

Site PTM Type Enzyme
N88 N-Glycosylation
S90 Phosphorylation
N124 N-Glycosylation
C151 S-Nitrosylation
N173 N-Glycosylation

Research Backgrounds

Function:

Modifies the functions of natural killer cells, monocytes and granulocytes. Inhibits C5a-dependent neutrophil enzyme release and chemotaxis. Capable of killing E.coli but not S.aureus in vitro; digests outer membrane protein A (ompA) in E.coli and K.pneumoniae.

Subcellular Location:

Cytoplasmic vesicle>Phagosome.
Note: Localized in phagolysosomes following ingestion of E.coli by neutrophils.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Bone marrow cells. Neutrophil.

Subunit Structure:

Interacts with NOTCH2NL.

Family&Domains:

Belongs to the peptidase S1 family. Elastase subfamily.

Research Fields

· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.

· Human Diseases > Immune diseases > Systemic lupus erythematosus.

References

1). IgD enhances the release of neutrophil extracellular traps (NETs) via FcδR in rheumatoid arthritis patients. International Immunopharmacology, 2023 (PubMed: 36450207) [IF=5.6]
2). Neutrophil extracellular traps promote gastric cancer metastasis by inducing epithelial‑mesenchymal transition. INTERNATIONAL JOURNAL OF MOLECULAR MEDICINE, 2021 (PubMed: 34013374) [IF=5.4]

Application: WB    Species: Human    Sample: GC tissues

Figure 3 Abundant NET deposition in human GC tissues. (A) NETs were visualized in GC tissues as extracellular structures decorated with neutrophil elastase (green) and citrullinated H3 (red) co-localizing with DAPI/DNA (blue), but the lack of NETs in normal resection edge. Scale bar, 50 µm; magnification, ×400. (B) Western blot analysis results revealed that the level of cit-H3 was increased in the gastric cancer tissues but nearly absence in normal gastric tissues. The blots are representatives of 3 experiments from 10 pairs of patients with similar results. (C) The values of protein band densities were normalized to cit-h3 protein level of normal group. Data are shown as the means ± SEM, #P<0.001 vs. normal group. NET, neutrophil extracellular trap; GC, gastric cancer; cit-h3, citrullinated histone H3.

Application: IF/ICC    Species: mouse    Sample: tumor

Figure 5.| Effects of NET inhibitors on solid tumor growth in nude mice.(E) Images showing representative immunostaining for neutrophil elastase (green), citrullinated histone H3 (red), and DAPI (blue) in the tumors of mice treated as indicated; scale bar, 50 µm; magnification, x400.
3). Transcriptomics Reveals Effect of Pulsatilla Decoction Butanol Extract in Alleviating Vulvovaginal Candidiasis by Inhibiting Neutrophil Chemotaxis and Activation via TLR4 Signaling. Pharmaceuticals (Basel, Switzerland), 2024 (PubMed: 38794163) [IF=4.6]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.