CD28 Antibody - #AF0014
Product: | CD28 Antibody |
Catalog: | AF0014 |
Description: | Rabbit polyclonal antibody to CD28 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 25 kDa; 25kD(Calculated). |
Uniprot: | P10747 |
RRID: | AB_2845462 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0014, RRID:AB_2845462.
Fold/Unfold
CD 28; CD28; CD28 antigen; CD28 molecule; CD28_HUMAN; MGC138290; T cell antigen CD28; T cell specific surface glycoprotein; T cell specific surface glycoprotein CD28; T-cell-specific surface glycoprotein CD28; TP44;
Immunogens
- P10747 CD28_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P10747 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
N37 | N-Glycosylation | Uniprot | |
N71 | N-Glycosylation | Uniprot | |
N105 | N-Glycosylation | Uniprot | |
N129 | N-Glycosylation | Uniprot | |
K136 | Ubiquitination | Uniprot | |
S189 | Phosphorylation | Uniprot | |
Y191 | Phosphorylation | P06239 (LCK) , Q08881 (ITK) , P06241 (FYN) | Uniprot |
T195 | Phosphorylation | Uniprot | |
K204 | Ubiquitination | Uniprot | |
Y206 | Phosphorylation | Uniprot | |
Y209 | Phosphorylation | Q08881 (ITK) | Uniprot |
Y218 | Phosphorylation | Q08881 (ITK) | Uniprot |
S220 | Phosphorylation | Uniprot |
Research Backgrounds
Involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival. Enhances the production of IL4 and IL10 in T-cells in conjunction with TCR/CD3 ligation and CD40L costimulation. Isoform 3 enhances CD40L-mediated activation of NF-kappa-B and kinases MAPK8 and PAK2 in T-cells.
CD40LG induces tyrosine phosphorylation of isoform 3.
Membrane>Single-pass type I membrane protein.
Cell surface.
Expressed in T-cells and plasma cells, but not in less mature B-cells.
Homodimer; disulfide-linked. Interacts with DUSP14. Binds to CD80/B7-1 and CD86/B7-2/B70. Interacts with GRB2. Isoform 3 interacts with CD40LG.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cell adhesion molecules (CAMs). (View pathway)
· Human Diseases > Endocrine and metabolic diseases > Type I diabetes mellitus.
· Human Diseases > Infectious diseases: Viral > Measles.
· Human Diseases > Immune diseases > Autoimmune thyroid disease.
· Human Diseases > Immune diseases > Systemic lupus erythematosus.
· Human Diseases > Immune diseases > Rheumatoid arthritis.
· Human Diseases > Immune diseases > Allograft rejection.
· Human Diseases > Immune diseases > Graft-versus-host disease.
· Human Diseases > Cardiovascular diseases > Viral myocarditis.
· Organismal Systems > Immune system > T cell receptor signaling pathway. (View pathway)
· Organismal Systems > Immune system > Intestinal immune network for IgA production. (View pathway)
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.