Product: GATA3 Antibody
Catalog: AF6233
Description: Rabbit polyclonal antibody to GATA3
Application: WB IHC IF/ICC
Cited expt.: WB, IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 47kDa(Observed); 48kD,51kD(Calculated).
Uniprot: P23771 | P23769
RRID: AB_2834800

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Zebrafish(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(100%), Xenopus(100%)
Clonality:
Polyclonal
Specificity:
GATA3 Antibody detects endogenous levels of total GATA3.
RRID:
AB_2834800
Cite Format: Affinity Biosciences Cat# AF6233, RRID:AB_2834800.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

GATA 3; GATA binding factor 3; GATA binding protein 3; GATA-binding factor 3; Gata3; GATA3_HUMAN; HDR; HDRS; MGC2346; MGC5199; MGC5445; Trans acting T cell specific transcription factor GATA 3; Trans-acting T-cell-specific transcription factor GATA-3; DCML; Endothelial transcription factor GATA 2; Endothelial transcription factor GATA-2; Endothelial transcription factor GATA2; FLJ45948; GATA 2; GATA binding protein 2; GATA-binding protein 2; Gata2; GATA2_HUMAN; IMD21; MGC2306; MONOMAC; NFE 1B; NFE1B; OTTHUMP00000216240;

Immunogens

Immunogen:

A synthesized peptide derived from human GATA3, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
P23771 GATA3_HUMAN:

T-cells and endothelial cells.

P23769 GATA2_HUMAN:

Endothelial cells.

Description:
GATA2 Transcriptional activator which regulates endothelin-1 gene expression in endothelial cells. Binds to the consensus sequence 5'-AGATAG-3'. Endothelial cells. 2 isoforms of the human protein are produced by alternative splicing.
Sequence:
MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHVPPYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVPLPDSMKLESSHSRGSMTALGGASSSTHHPITTYPPYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPTPMHPPSSLSFGPHHPSSMVTAMG

MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKCMQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Xenopus
100
Zebrafish
100
Chicken
100
Rabbit
100
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Transcriptional activator which binds to the enhancer of the T-cell receptor alpha and delta genes. Binds to the consensus sequence 5'-AGATAG-3'. Required for the T-helper 2 (Th2) differentiation process following immune and inflammatory responses.

Subcellular Location:

Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

T-cells and endothelial cells.

Family&Domains:

Binds DNA via the 2 GATA-type zinc fingers. Each zinc finger may bind either adjacent sites in a palindromic motif, or a different DNA molecule allowing looping and long-range gene regulation.

The YxKxHxxxRP motif is critical for DNA-binding and function.

Function:

Transcriptional activator which regulates endothelin-1 gene expression in endothelial cells. Binds to the consensus sequence 5'-AGATAG-3'.

Subcellular Location:

Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Endothelial cells.

Research Fields

· Human Diseases > Immune diseases > Inflammatory bowel disease (IBD).

· Organismal Systems > Immune system > Th1 and Th2 cell differentiation.   (View pathway)

· Organismal Systems > Immune system > Th17 cell differentiation.   (View pathway)

References

1). Chronic low-grade inflammation is involved in TLR4 knockout-induced spontaneous obesity in aged mice. BIOMEDICINE & PHARMACOTHERAPY, 2022 (PubMed: 35093760) [IF=6.9]

Application: WB    Species: Mouse    Sample:

Fig. 6. TLR4 KO affected the differentiation of Th cells in the spleen of 18 M old mice. a Relative image of the spleen and spleen index, n = 6. b Relative mRNA expression of Tbet, Gata3, Rorγt and Foxp3, n = 6. c Relative mRNA expression of important Th downstream genes in the spleen, n = 6. d Protein expression of Tbet, Gata3, Rorγt and Foxp3 and the relative Tbet, Gata3, Rorγt and Foxp3 protein levels is shown in bar graph, n = 3. e Serum levels of IL-1β, IL-6, IL-10 and TNF-α protein were measured by ELISA, n = 8. Data are presented as mean ± S.E.M.

2). Compound Danshen Dripping Pill inhibits doxorubicin or isoproterenol-induced cardiotoxicity. Biomedicine & Pharmacotherapy, 2021 (PubMed: 34311530) [IF=6.9]

3). Vorinostat decrease M2 macrophage polarization through ARID1A6488delG/HDAC6/IL-10 signaling pathway in endometriosis-associated ovarian carcinoma. Biomedicine & Pharmacotherapy, 2023 (PubMed: 36958195) [IF=6.9]

Application: WB    Species: Mouse    Sample:

Fig. 3. HDAC6 mediated M2 macrophage polarization, (A, B) Two micrograms of HDAC6 plasmid was transfected into the EAOC cell line, and HDAC6 and GATA3 protein expression was analyzed by western blotting. B-actin was analyzed to normalize protein expression levels. (C, D, E and F) The levels of IL-1B, IL-4, IL-10 and IL-13 were analyzed by ELISA kits. (G) Two micrograms of HDAC6, GATA3 siRNA1/2 and GATA3 siRNA1/2 +HDAC6 plasmids were transfected into the EAOC cell line, and the level of IL-10 was analyzed by ELISA. (H) The flow chart shows the process of macrophage polarization, and macrophage surface markers were analyzed by flow cytometry. (I) Two micrograms of HDAC6 plasmid was transfected into the EAOC cell line, and macrophage polarization was analyzed by flow cytometry. Data are the mean ± SD from three independent experiments. * P 

4). YY1/HIF-1α/mROS positive-feedback loop exacerbates glomerular mesangial cell proliferation in mouse early diabetic kidney disease. Acta pharmacologica Sinica, 2025 (PubMed: 40038466) [IF=6.9]

5). Siweixizangmaoru decoction attenuates collagen-induced arthritis via gut microbiota-dependent SCFA restoration and immunomodulation. Phytomedicine : international journal of phytotherapy and phytopharmacology, 2025 (PubMed: 40946662) [IF=6.7]

6). Overexpressed GATA3 enhances the sensitivity of colorectal cancer cells to oxaliplatin through regulating MiR-29b. Cancer Cell International, 2020 (PubMed: 32760217) [IF=5.8]

Application: WB    Species: human    Sample: HT-29 and DLD1 cells

Fig. 4| GATA3 inhibits Oxa resistance of CRC cells by miR-29b.c-f Apoptosis and apoptosis rate of HT-29 and DLD1 cells in each group (g, h) GATA3 and Caspase3+cleaved caspase3 protein levels in HT-29 and DLD1 cells.

7). Regulatory effects of miRNA-126 on Th cell differentiation and cytokine expression in allergic rhinitis. Cellular Signalling, 2022 (PubMed: 35953026) [IF=4.4]

8). Downregulation of CCL22 and mutated NOTCH1 in tongue and mouth floor squamous cell carcinoma results in decreased Th2 cell recruitment and expression, predicting poor clinical outcome. BMC Cancer, 2021 (PubMed: 34391381) [IF=3.8]

Application: IHC    Species: Human    Sample: SCC tissues

Fig. 7 Protein levels of CCL22, GATA-3, and IL4 in tongue SCC tissues. (A) Immunohistochemical analysis of CCL22, GATA-3, and IL4 expression in tumor specimens between different clinical stages (× 200; scale bars = 50 μm). (B) Labeling index of CCL22, GATA-3, and IL4 in early- and advanced-stage T/MF SCC. The labeling index of CCL22 was positively correlated with that of (C) GATA-3 and (D) IL4.

9). Comparison of Two Erythronium sibiricum Bulb Polysaccharides in Anti-asthmatic Mechanisms Based on Th1/Th2 and Treg/Th17 Balances. Research Square, 2022

10). Иммуногистохимическая характеристика биопсийных образцов десны в области беззубого альвеолярного края челюсти. Пародонтология, 2024

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.