Product: Phospho-14-3-3 zeta/delta (Thr232) Antibody
Catalog: AF3357
Description: Rabbit polyclonal antibody to Phospho-14-3-3 zeta/delta (Thr232)
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 28kDa; 28kD(Calculated).
Uniprot: P63104 | P31946
RRID: AB_2834772

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(100%), Xenopus(100%)
Clonality:
Polyclonal
Specificity:
Phospho-14-3-3 zeta/delta (Thr232) Antibody detects endogenous levels of 14-3-3 zeta/delta only when phosphorylated at Threonine 232.
RRID:
AB_2834772
Cite Format: Affinity Biosciences Cat# AF3357, RRID:AB_2834772.
Conjugate:
Unconjugated.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

14 3 3 delta; 14 3 3 protein zeta/delta; 14 3 3 protein/cytosolic phospholipase A2; 14 3 3 zeta; 14-3-3 protein zeta/delta; 1433Z_HUMAN; Epididymis luminal protein 4; Epididymis secretory protein Li 3; HEL S 3; HEL4; KCIP-1; KCIP1; MGC111427; MGC126532; MGC138156; Phospholipase A2; Protein kinase C inhibitor protein 1; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, delta polypeptide; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, zeta; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, zeta polypeptide; Tyrosine 3/tryptophan 5 monooxygenase activation protein, zeta polypeptide; YWHAD; YWHAZ;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Description:
14-3-3 zeta is a protein of the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins.
Sequence:
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN

MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Horse
100
Bovine
100
Sheep
100
Dog
100
Xenopus
100
Chicken
100
Rabbit
100
Zebrafish
75
Pig
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P63104/P31946 As Substrate

Site PTM Type Enzyme
M1 Acetylation
K3 Acetylation
K3 Methylation
K3 Ubiquitination
K9 Acetylation
K9 Ubiquitination
K11 Acetylation
K11 Ubiquitination
Y19 Phosphorylation
C25 S-Nitrosylation
K27 Ubiquitination
S28 Phosphorylation
S37 Phosphorylation
S45 Phosphorylation
Y48 Phosphorylation
K49 Acetylation
K49 Methylation
K49 Ubiquitination
S57 Phosphorylation
S58 Phosphorylation P31749 (AKT1) , P49137 (MAPKAPK2) , P17612 (PRKACA) , O00506 (STK25) , Q05655 (PRKCD)
S63 Phosphorylation
S64 Phosphorylation
K68 Acetylation
K68 Ubiquitination
K74 Acetylation
K74 Ubiquitination
K75 Acetylation
K75 Ubiquitination
Y82 Phosphorylation
K85 Acetylation
K85 Methylation
K85 Ubiquitination
T88 Phosphorylation
C94 S-Nitrosylation
S99 Phosphorylation
K103 Ubiquitination
S110 Phosphorylation
S114 Phosphorylation
K115 Acetylation
K115 Ubiquitination
K120 Acetylation
K120 Ubiquitination
K122 Ubiquitination
Y125 Phosphorylation
Y126 Phosphorylation
Y128 Phosphorylation
K138 Acetylation
K138 Ubiquitination
K139 Acetylation
K139 Ubiquitination
S145 Phosphorylation
Y149 Phosphorylation
K157 Acetylation
K157 Ubiquitination
K158 Ubiquitination
Y178 Phosphorylation
S184 Phosphorylation P53779 (MAPK10) , P45984 (MAPK9) , P45983 (MAPK8)
C189 S-Nitrosylation
K193 Ubiquitination
T194 Phosphorylation
T205 Phosphorylation
S207 Phosphorylation
S210 Phosphorylation
Y211 Phosphorylation
K212 Methylation
S214 Phosphorylation
T215 Phosphorylation
T229 Phosphorylation
S230 Phosphorylation
T232 Phosphorylation P48729 (CSNK1A1) , P11274 (BCR)
Site PTM Type Enzyme
M1 Acetylation
T2 Acetylation
T2 Phosphorylation
K5 Acetylation
K5 Ubiquitination
S6 Phosphorylation
K11 Ubiquitination
K13 Acetylation
K13 Ubiquitination
Y21 Phosphorylation
K29 Ubiquitination
T32 Phosphorylation
S39 Phosphorylation
S47 Phosphorylation
Y50 Phosphorylation
K51 Acetylation
K51 Methylation
K51 Ubiquitination
S59 Phosphorylation
S60 Phosphorylation Q05655 (PRKCD)
S66 Phosphorylation
K70 Acetylation
K70 Ubiquitination
K77 Acetylation
K82 Acetylation
K82 Ubiquitination
K87 Ubiquitination
K105 Ubiquitination
Y106 Phosphorylation
S116 Phosphorylation
K117 Acetylation
K117 Ubiquitination
Y120 Phosphorylation
K122 Acetylation
K122 Ubiquitination
K124 Ubiquitination
Y127 Phosphorylation
Y130 Phosphorylation
S132 Phosphorylation O14920 (IKBKB)
S136 Phosphorylation
K140 Ubiquitination
Y151 Phosphorylation
K159 Acetylation
K159 Ubiquitination
K160 Ubiquitination
Y180 Phosphorylation
S186 Phosphorylation P45983 (MAPK8)
K195 Ubiquitination
T207 Phosphorylation
S212 Phosphorylation
Y213 Phosphorylation
S216 Phosphorylation
T217 Phosphorylation
T228 Phosphorylation
T231 Phosphorylation
S232 Phosphorylation

Research Backgrounds

Function:

Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Induces ARHGEF7 activity on RAC1 as well as lamellipodia and membrane ruffle formation. In neurons, regulates spine maturation through the modulation of ARHGEF7 activity (By similarity).

PTMs:

The delta, brain-specific form differs from the zeta form in being phosphorylated (By similarity). Phosphorylation on Ser-184 by MAPK8; promotes dissociation of BAX and translocation of BAX to mitochondria. Phosphorylation on Thr-232; inhibits binding of RAF1. Phosphorylated on Ser-58 by PKA and protein kinase C delta type catalytic subunit in a sphingosine-dependent fashion. Phosphorylation on Ser-58 by PKA; disrupts homodimerization and heterodimerization with YHAE and TP53.

Subcellular Location:

Cytoplasm. Melanosome.
Note: Located to stage I to stage IV melanosomes.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Interacts with CDK16 and BSPRY (By similarity). Interacts with WEE1 (C-terminal). Interacts with SAMSN1 (By similarity). Interacts with MLF1 (phosphorylated form); the interaction retains it in the cytoplasm (By similarity). Interacts with Thr-phosphorylated ITGB2 (By similarity). Interacts with BCL2L11 (By similarity). Homodimer. Heterodimerizes with YWHAE. Homo- and heterodimerization is inhibited by phosphorylation on Ser-58. Interacts with FOXO4, NOXA1, SSH1 and ARHGEF2. Interacts with Pseudomonas aeruginosa exoS (unphosphorylated form). Interacts with BAX; the interaction occurs in the cytoplasm. Under stress conditions, MAPK8-mediated phosphorylation releases BAX to mitochondria. Interacts with phosphorylated RAF1; the interaction is inhibited when YWHAZ is phosphorylated on Thr-232. Interacts with BRAF. Interacts with TP53; the interaction enhances p53 transcriptional activity. The Ser-58 phosphorylated form inhibits this interaction and p53 transcriptional activity. Interacts with ABL1 (phosphorylated form); the interaction retains ABL1 in the cytoplasm. Interacts with PKA-phosphorylated AANAT; the interaction modulates AANAT enzymatic activity by increasing affinity for arylalkylamines and acetyl-CoA and protecting the enzyme from dephosphorylation and proteasomal degradation. It may also prevent thiol-dependent inactivation. Interacts with AKT1; the interaction phosphorylates YWHAZ and modulates dimerization. Interacts with GAB2 and TLK2. Interacts with the 'Thr-369' phosphorylated form of DAPK2. Interacts with PI4KB, TBC1D22A and TBC1D22B. Interacts with ZFP36L1 (via phosphorylated form); this interaction occurs in a p38 MAPK- and AKT-signaling pathways (By similarity). Interacts with SLITRK1. Interacts with AK5, LDB1, MADD, MARK3, PDE1A and SMARCB1.

Family&Domains:

Belongs to the 14-3-3 family.

Function:

Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negative regulator of osteogenesis. Blocks the nuclear translocation of the phosphorylated form (by AKT1) of SRPK2 and antagonizes its stimulatory effect on cyclin D1 expression resulting in blockage of neuronal apoptosis elicited by SRPK2. Negative regulator of signaling cascades that mediate activation of MAP kinases via AKAP13.

PTMs:

The alpha, brain-specific form differs from the beta form in being phosphorylated. Phosphorylated on Ser-60 by protein kinase C delta type catalytic subunit in a sphingosine-dependent fashion.

Subcellular Location:

Cytoplasm. Melanosome.
Note: Identified by mass spectrometry in melanosome fractions from stage I to stage IV.

Vacuole membrane.
Note: (Microbial infection) Upon infection with Chlamydia trachomatis, this protein is associated with the pathogen-containing vacuole membrane where it colocalizes with IncG.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Homodimer. Interacts with SAMSN1 and PRKCE (By similarity). Interacts with AKAP13. Interacts with SSH1 and TORC2/CRTC2. Interacts with ABL1; the interaction results in cytoplasmic location of ABL1 and inhibition of cABL-mediated apoptosis. Interacts with ROR2 (dimer); the interaction results in phosphorylation of YWHAB on tyrosine residues. Interacts with GAB2. Interacts with YAP1 (phosphorylated form). Interacts with the phosphorylated (by AKT1) form of SRPK2. Interacts with PKA-phosphorylated AANAT. Interacts with MYO1C. Interacts with SIRT2. Interacts with the 'Thr-369' phosphorylated form of DAPK2. Interacts with PI4KB, TBC1D22A and TBC1D22B. Interacts with the 'Ser-1134' and 'Ser-1161' phosphorylated form of SOS1. Interacts (via phosphorylated form) with YWHAB; this interaction occurs in a protein kinase AKT1-dependent manner. Interacts with SLITRK1. Interacts with SYNPO2 (phosphorylated form); YWHAB competes with ACTN2 for interaction with SYNPO2 (By similarity). Interacts with RIPOR2 (via phosphorylated form) isoform 2; this interaction occurs in a chemokine-dependent manner and does not compete for binding of RIPOR2 with RHOA nor blocks inhibition of RIPOR2-mediated RHOA activity. Interacts with MARK2 and MARK3.

(Microbial infection) Interacts with herpes simplex virus 1 protein UL46.

(Microbial infection) Probably interacts with Chlamydia trachomatis protein IncG.

Family&Domains:

Belongs to the 14-3-3 family.

Research Fields

· Cellular Processes > Cell growth and death > Cell cycle.   (View pathway)

· Cellular Processes > Cell growth and death > Oocyte meiosis.   (View pathway)

· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Hippo signaling pathway.   (View pathway)

· Human Diseases > Infectious diseases: Bacterial > Pathogenic Escherichia coli infection.

· Human Diseases > Infectious diseases: Viral > Hepatitis B.

· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.

· Human Diseases > Cancers: Overview > Viral carcinogenesis.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.