Phospho-14-3-3 zeta/delta (Thr232) Antibody - #AF3357
Product: | Phospho-14-3-3 zeta/delta (Thr232) Antibody |
Catalog: | AF3357 |
Description: | Rabbit polyclonal antibody to Phospho-14-3-3 zeta/delta (Thr232) |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 28kDa; 28kD(Calculated). |
Uniprot: | P63104 | P31946 |
RRID: | AB_2834772 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF3357, RRID:AB_2834772.
Fold/Unfold
14 3 3 delta; 14 3 3 protein zeta/delta; 14 3 3 protein/cytosolic phospholipase A2; 14 3 3 zeta; 14-3-3 protein zeta/delta; 1433Z_HUMAN; Epididymis luminal protein 4; Epididymis secretory protein Li 3; HEL S 3; HEL4; KCIP-1; KCIP1; MGC111427; MGC126532; MGC138156; Phospholipase A2; Protein kinase C inhibitor protein 1; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, delta polypeptide; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, zeta; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, zeta polypeptide; Tyrosine 3/tryptophan 5 monooxygenase activation protein, zeta polypeptide; YWHAD; YWHAZ;
Immunogens
- P63104 1433Z_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN
- P31946 1433B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P63104/P31946 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
M1 | Acetylation | Uniprot | |
K3 | Acetylation | Uniprot | |
K3 | Methylation | Uniprot | |
K3 | Ubiquitination | Uniprot | |
K9 | Acetylation | Uniprot | |
K9 | Ubiquitination | Uniprot | |
K11 | Acetylation | Uniprot | |
K11 | Ubiquitination | Uniprot | |
Y19 | Phosphorylation | Uniprot | |
C25 | S-Nitrosylation | Uniprot | |
K27 | Ubiquitination | Uniprot | |
S28 | Phosphorylation | Uniprot | |
S37 | Phosphorylation | Uniprot | |
S45 | Phosphorylation | Uniprot | |
Y48 | Phosphorylation | Uniprot | |
K49 | Acetylation | Uniprot | |
K49 | Methylation | Uniprot | |
K49 | Ubiquitination | Uniprot | |
S57 | Phosphorylation | Uniprot | |
S58 | Phosphorylation | P31749 (AKT1) , P49137 (MAPKAPK2) , P17612 (PRKACA) , O00506 (STK25) , Q05655 (PRKCD) | Uniprot |
S63 | Phosphorylation | Uniprot | |
S64 | Phosphorylation | Uniprot | |
K68 | Acetylation | Uniprot | |
K68 | Ubiquitination | Uniprot | |
K74 | Acetylation | Uniprot | |
K74 | Ubiquitination | Uniprot | |
K75 | Acetylation | Uniprot | |
K75 | Ubiquitination | Uniprot | |
Y82 | Phosphorylation | Uniprot | |
K85 | Acetylation | Uniprot | |
K85 | Methylation | Uniprot | |
K85 | Ubiquitination | Uniprot | |
T88 | Phosphorylation | Uniprot | |
C94 | S-Nitrosylation | Uniprot | |
S99 | Phosphorylation | Uniprot | |
K103 | Ubiquitination | Uniprot | |
S110 | Phosphorylation | Uniprot | |
S114 | Phosphorylation | Uniprot | |
K115 | Acetylation | Uniprot | |
K115 | Ubiquitination | Uniprot | |
K120 | Acetylation | Uniprot | |
K120 | Ubiquitination | Uniprot | |
K122 | Ubiquitination | Uniprot | |
Y125 | Phosphorylation | Uniprot | |
Y126 | Phosphorylation | Uniprot | |
Y128 | Phosphorylation | Uniprot | |
K138 | Acetylation | Uniprot | |
K138 | Ubiquitination | Uniprot | |
K139 | Acetylation | Uniprot | |
K139 | Ubiquitination | Uniprot | |
S145 | Phosphorylation | Uniprot | |
Y149 | Phosphorylation | Uniprot | |
K157 | Acetylation | Uniprot | |
K157 | Ubiquitination | Uniprot | |
K158 | Ubiquitination | Uniprot | |
Y178 | Phosphorylation | Uniprot | |
S184 | Phosphorylation | P53779 (MAPK10) , P45984 (MAPK9) , P45983 (MAPK8) | Uniprot |
C189 | S-Nitrosylation | Uniprot | |
K193 | Ubiquitination | Uniprot | |
T194 | Phosphorylation | Uniprot | |
T205 | Phosphorylation | Uniprot | |
S207 | Phosphorylation | Uniprot | |
S210 | Phosphorylation | Uniprot | |
Y211 | Phosphorylation | Uniprot | |
K212 | Methylation | Uniprot | |
S214 | Phosphorylation | Uniprot | |
T215 | Phosphorylation | Uniprot | |
T229 | Phosphorylation | Uniprot | |
S230 | Phosphorylation | Uniprot | |
T232 | Phosphorylation | P48729 (CSNK1A1) , P11274 (BCR) | Uniprot |
Site | PTM Type | Enzyme | Source |
---|---|---|---|
M1 | Acetylation | Uniprot | |
T2 | Acetylation | Uniprot | |
T2 | Phosphorylation | Uniprot | |
K5 | Acetylation | Uniprot | |
K5 | Ubiquitination | Uniprot | |
S6 | Phosphorylation | Uniprot | |
K11 | Ubiquitination | Uniprot | |
K13 | Acetylation | Uniprot | |
K13 | Ubiquitination | Uniprot | |
Y21 | Phosphorylation | Uniprot | |
K29 | Ubiquitination | Uniprot | |
T32 | Phosphorylation | Uniprot | |
S39 | Phosphorylation | Uniprot | |
S47 | Phosphorylation | Uniprot | |
Y50 | Phosphorylation | Uniprot | |
K51 | Acetylation | Uniprot | |
K51 | Methylation | Uniprot | |
K51 | Ubiquitination | Uniprot | |
S59 | Phosphorylation | Uniprot | |
S60 | Phosphorylation | Q05655 (PRKCD) | Uniprot |
S66 | Phosphorylation | Uniprot | |
K70 | Acetylation | Uniprot | |
K70 | Ubiquitination | Uniprot | |
K77 | Acetylation | Uniprot | |
K82 | Acetylation | Uniprot | |
K82 | Ubiquitination | Uniprot | |
K87 | Ubiquitination | Uniprot | |
K105 | Ubiquitination | Uniprot | |
Y106 | Phosphorylation | Uniprot | |
S116 | Phosphorylation | Uniprot | |
K117 | Acetylation | Uniprot | |
K117 | Ubiquitination | Uniprot | |
Y120 | Phosphorylation | Uniprot | |
K122 | Acetylation | Uniprot | |
K122 | Ubiquitination | Uniprot | |
K124 | Ubiquitination | Uniprot | |
Y127 | Phosphorylation | Uniprot | |
Y130 | Phosphorylation | Uniprot | |
S132 | Phosphorylation | O14920 (IKBKB) | Uniprot |
S136 | Phosphorylation | Uniprot | |
K140 | Ubiquitination | Uniprot | |
Y151 | Phosphorylation | Uniprot | |
K159 | Acetylation | Uniprot | |
K159 | Ubiquitination | Uniprot | |
K160 | Ubiquitination | Uniprot | |
Y180 | Phosphorylation | Uniprot | |
S186 | Phosphorylation | P45983 (MAPK8) | Uniprot |
K195 | Ubiquitination | Uniprot | |
T207 | Phosphorylation | Uniprot | |
S212 | Phosphorylation | Uniprot | |
Y213 | Phosphorylation | Uniprot | |
S216 | Phosphorylation | Uniprot | |
T217 | Phosphorylation | Uniprot | |
T228 | Phosphorylation | Uniprot | |
T231 | Phosphorylation | Uniprot | |
S232 | Phosphorylation | Uniprot |
Research Backgrounds
Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Induces ARHGEF7 activity on RAC1 as well as lamellipodia and membrane ruffle formation. In neurons, regulates spine maturation through the modulation of ARHGEF7 activity (By similarity).
The delta, brain-specific form differs from the zeta form in being phosphorylated (By similarity). Phosphorylation on Ser-184 by MAPK8; promotes dissociation of BAX and translocation of BAX to mitochondria. Phosphorylation on Thr-232; inhibits binding of RAF1. Phosphorylated on Ser-58 by PKA and protein kinase C delta type catalytic subunit in a sphingosine-dependent fashion. Phosphorylation on Ser-58 by PKA; disrupts homodimerization and heterodimerization with YHAE and TP53.
Cytoplasm. Melanosome.
Note: Located to stage I to stage IV melanosomes.
Interacts with CDK16 and BSPRY (By similarity). Interacts with WEE1 (C-terminal). Interacts with SAMSN1 (By similarity). Interacts with MLF1 (phosphorylated form); the interaction retains it in the cytoplasm (By similarity). Interacts with Thr-phosphorylated ITGB2 (By similarity). Interacts with BCL2L11 (By similarity). Homodimer. Heterodimerizes with YWHAE. Homo- and heterodimerization is inhibited by phosphorylation on Ser-58. Interacts with FOXO4, NOXA1, SSH1 and ARHGEF2. Interacts with Pseudomonas aeruginosa exoS (unphosphorylated form). Interacts with BAX; the interaction occurs in the cytoplasm. Under stress conditions, MAPK8-mediated phosphorylation releases BAX to mitochondria. Interacts with phosphorylated RAF1; the interaction is inhibited when YWHAZ is phosphorylated on Thr-232. Interacts with BRAF. Interacts with TP53; the interaction enhances p53 transcriptional activity. The Ser-58 phosphorylated form inhibits this interaction and p53 transcriptional activity. Interacts with ABL1 (phosphorylated form); the interaction retains ABL1 in the cytoplasm. Interacts with PKA-phosphorylated AANAT; the interaction modulates AANAT enzymatic activity by increasing affinity for arylalkylamines and acetyl-CoA and protecting the enzyme from dephosphorylation and proteasomal degradation. It may also prevent thiol-dependent inactivation. Interacts with AKT1; the interaction phosphorylates YWHAZ and modulates dimerization. Interacts with GAB2 and TLK2. Interacts with the 'Thr-369' phosphorylated form of DAPK2. Interacts with PI4KB, TBC1D22A and TBC1D22B. Interacts with ZFP36L1 (via phosphorylated form); this interaction occurs in a p38 MAPK- and AKT-signaling pathways (By similarity). Interacts with SLITRK1. Interacts with AK5, LDB1, MADD, MARK3, PDE1A and SMARCB1.
Belongs to the 14-3-3 family.
Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negative regulator of osteogenesis. Blocks the nuclear translocation of the phosphorylated form (by AKT1) of SRPK2 and antagonizes its stimulatory effect on cyclin D1 expression resulting in blockage of neuronal apoptosis elicited by SRPK2. Negative regulator of signaling cascades that mediate activation of MAP kinases via AKAP13.
The alpha, brain-specific form differs from the beta form in being phosphorylated. Phosphorylated on Ser-60 by protein kinase C delta type catalytic subunit in a sphingosine-dependent fashion.
Cytoplasm. Melanosome.
Note: Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
Vacuole membrane.
Note: (Microbial infection) Upon infection with Chlamydia trachomatis, this protein is associated with the pathogen-containing vacuole membrane where it colocalizes with IncG.
Homodimer. Interacts with SAMSN1 and PRKCE (By similarity). Interacts with AKAP13. Interacts with SSH1 and TORC2/CRTC2. Interacts with ABL1; the interaction results in cytoplasmic location of ABL1 and inhibition of cABL-mediated apoptosis. Interacts with ROR2 (dimer); the interaction results in phosphorylation of YWHAB on tyrosine residues. Interacts with GAB2. Interacts with YAP1 (phosphorylated form). Interacts with the phosphorylated (by AKT1) form of SRPK2. Interacts with PKA-phosphorylated AANAT. Interacts with MYO1C. Interacts with SIRT2. Interacts with the 'Thr-369' phosphorylated form of DAPK2. Interacts with PI4KB, TBC1D22A and TBC1D22B. Interacts with the 'Ser-1134' and 'Ser-1161' phosphorylated form of SOS1. Interacts (via phosphorylated form) with YWHAB; this interaction occurs in a protein kinase AKT1-dependent manner. Interacts with SLITRK1. Interacts with SYNPO2 (phosphorylated form); YWHAB competes with ACTN2 for interaction with SYNPO2 (By similarity). Interacts with RIPOR2 (via phosphorylated form) isoform 2; this interaction occurs in a chemokine-dependent manner and does not compete for binding of RIPOR2 with RHOA nor blocks inhibition of RIPOR2-mediated RHOA activity. Interacts with MARK2 and MARK3.
(Microbial infection) Interacts with herpes simplex virus 1 protein UL46.
(Microbial infection) Probably interacts with Chlamydia trachomatis protein IncG.
Belongs to the 14-3-3 family.
Research Fields
· Cellular Processes > Cell growth and death > Cell cycle. (View pathway)
· Cellular Processes > Cell growth and death > Oocyte meiosis. (View pathway)
· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Hippo signaling pathway. (View pathway)
· Human Diseases > Infectious diseases: Bacterial > Pathogenic Escherichia coli infection.
· Human Diseases > Infectious diseases: Viral > Hepatitis B.
· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.
· Human Diseases > Cancers: Overview > Viral carcinogenesis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.