PPP3R1 Antibody - #DF9292
| Product: | PPP3R1 Antibody | 
| Catalog: | DF9292 | 
| Description: | Rabbit polyclonal antibody to PPP3R1 | 
| Application: | WB | 
| Reactivity: | Human, Mouse, Rat | 
| Prediction: | Pig, Bovine, Horse, Chicken, Xenopus | 
| Mol.Wt.: | 19 kDa, 16 kDa; 19kD(Calculated). | 
| Uniprot: | P63098 | 
| RRID: | AB_2842488 | 
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9292, RRID:AB_2842488.
Fold/Unfold
alpha isoform (calcineurin B, type I); calcineurin B, type I (19kDa); Calcineurin subunit B type 1; CALNB1; CANB1_HUMAN; Cna2; CNB; CNB1; OTTHUMP00000201960; OTTHUMP00000201961; Ppp3r1; PPP3R1 protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform; protein phosphatase3 (formerly2B), regulatory subunit B, alpha isoform; Protein phosphatase 2B regulatory subunit 1; Protein phosphatase 2B regulatory subunit B alpha; protein phosphatase 3 (formerly 2B), regulatory subunit B, 19kDa, alpha isoform (calcineurin B, type I); Protein phosphatase 3 (formerly 2B), regulatory subunit B (19kD), alpha isoform (calcineurin B, type I); Protein phosphatase 3 regulatory subunit B alpha; Protein phosphatase 3 regulatory subunit B alpha isoform 1;
Immunogens
A synthesized peptide derived from human PPP3R1, corresponding to a region within the internal amino acids.
- P63098 CANB1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity.
Cytoplasm>Cytosol. Cell membrane. Cell membrane>Sarcolemma. Cell membrane>Lipid-anchor. 
Note: Translocates from the cytosol to the sarcolemma in a CIB1-dependent manner during cardiomyocyte hypertrophy.
Belongs to the calcineurin regulatory subunit family.
Research Fields
· Cellular Processes > Cell growth and death > Oocyte meiosis. (View pathway)
· Cellular Processes > Cell growth and death > Cellular senescence. (View pathway)
· Environmental Information Processing > Signal transduction > MAPK signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Calcium signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > cGMP-PKG signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Wnt signaling pathway. (View pathway)
· Human Diseases > Neurodegenerative diseases > Alzheimer's disease.
· Human Diseases > Neurodegenerative diseases > Amyotrophic lateral sclerosis (ALS).
· Human Diseases > Substance dependence > Amphetamine addiction.
· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.
· Human Diseases > Infectious diseases: Viral > HTLV-I infection.
· Organismal Systems > Development > Axon guidance. (View pathway)
· Organismal Systems > Development > Osteoclast differentiation. (View pathway)
· Organismal Systems > Immune system > Natural killer cell mediated cytotoxicity. (View pathway)
· Organismal Systems > Immune system > Th1 and Th2 cell differentiation. (View pathway)
· Organismal Systems > Immune system > Th17 cell differentiation. (View pathway)
· Organismal Systems > Immune system > T cell receptor signaling pathway. (View pathway)
· Organismal Systems > Immune system > B cell receptor signaling pathway. (View pathway)
· Organismal Systems > Nervous system > Long-term potentiation.
· Organismal Systems > Nervous system > Glutamatergic synapse.
· Organismal Systems > Endocrine system > Oxytocin signaling pathway.
· Organismal Systems > Endocrine system > Glucagon signaling pathway.
· Organismal Systems > Endocrine system > Renin secretion.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.
 
											