IFN14 Antibody - #DF8966
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8966, RRID:AB_2842162.
Fold/Unfold
IFN-alpha-14; IFN14_HUMAN; IFNA14; Interferon alpha 14; Interferon alpha H; Interferon alpha-14; Interferon alpha-H; Interferon lambda-2-H; Interferon lambda2H; LeIF H; LeIFH; MGC125756; MGC125757; IFN-alpha-10; IFN10_HUMAN; IFNA10; Interferon alpha 6L; Interferon alpha C; Interferon alpha-10; Interferon alpha-6L; Interferon alpha-C; interferon, alpha 10; LeIF C; MGC119878; MGC119879; IFN-alpha-4; IFN-alpha4a; INFA4; Interferon alpha 4 precursor; Interferon alpha 4B; Interferon alpha 76; Interferon alpha M1; Interferon, alpha 4; IFN alpha 7; IFN alpha J1; IFN alphaJ; IFN-alpha-7; IFN-alpha-J1; IFNA 7; IFNA J; IFNA7; IFNA7_HUMAN; Interferon alpha 7; Interferon alpha family, gene 7; Interferon alpha J; Interferon alpha J1; Interferon alpha-7; Interferon alpha-J; Interferon alpha-J1; LeIF J; OTTHUMP00000021136; OTTMUSP00000012102; RP23-139P14.26;
Immunogens
P01570(IFN14_HUMAN) >>Visit HPA database.
P01566(IFN10_HUMAN) >>Visit HPA database.
- P01570 IFN14_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MALPFALMMALVVLSCKSSCSLGCNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD
- P01566 IFN10_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLGQMGRISPFSCLKDRHDFRIPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLEACVIQEVGVEETPLMNEDSILAVRKYFQRITLYLIERKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD
- P05014 IFNA4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISHFSCLKDRHDFGFPEEEFDGHQFQKAQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLEACVIQEVGVEETPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD
- P01567 IFNA7_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MARSFSLLMVVLVLSYKSICSLGCDLPQTHSLRNRRALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLEACVIQEVGVEETPLMNEDFILAVRKYFQRITLYLMEKKYSPCAWEVVRAEIMRSFSFSTNLKKGLRRKD
PTMs - P01570/P01566/P05014/P01567 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K54 | Acetylation | Uniprot |
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| R45 | Methylation | Uniprot | |
| R46 | Methylation | Uniprot | |
| N95 | N-Glycosylation | Uniprot |
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Y16 | Phosphorylation | Uniprot |
Research Backgrounds
Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
Secreted.
Belongs to the alpha/beta interferon family.
Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
Secreted.
Belongs to the alpha/beta interferon family.
Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
Secreted.
Belongs to the alpha/beta interferon family.
Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
Secreted.
Belongs to the alpha/beta interferon family.
Research Fields
· Cellular Processes > Cell growth and death > Necroptosis. (View pathway)
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway. (View pathway)
· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.
· Human Diseases > Infectious diseases: Viral > Hepatitis C.
· Human Diseases > Infectious diseases: Viral > Hepatitis B.
· Human Diseases > Infectious diseases: Viral > Measles.
· Human Diseases > Infectious diseases: Viral > Influenza A.
· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.
· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.
· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)
· Human Diseases > Immune diseases > Autoimmune thyroid disease.
· Organismal Systems > Immune system > Toll-like receptor signaling pathway. (View pathway)
· Organismal Systems > Immune system > NOD-like receptor signaling pathway. (View pathway)
· Organismal Systems > Immune system > RIG-I-like receptor signaling pathway. (View pathway)
· Organismal Systems > Immune system > Cytosolic DNA-sensing pathway. (View pathway)
· Organismal Systems > Immune system > Natural killer cell mediated cytotoxicity. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.