HES1 Antibody | Affinity Biosciences

IHC
Cites

1/5

DF7569 at 1/100 staining Human gastric tissue by IHC-P.

FIGURE 5| The expression of VEGF‐Notch signaling pathway related proteins (VEGF, VEGFR, Notch‐1, Jagged1, Delta‐like1, and hes1)in HUVECs cocultured with VEGF/Notch shRNA transfected BMSCs (n = 3).

Fig.

FIGURE 7 | Hes1 expression is negatively regulated by miR-9 in NSCs.

Figure 6 Minocycline alleviates sevoflurane-induced neuroinflammation via Notch signaling suppression: (A) Cell immunofluorescence was performed to assess Notch signaling-associated proteins in BV2 cells of each group.

Product:	HES1 Antibody
Catalog:	DF7569
Description:	Rabbit polyclonal antibody to HES1
Application:	WB IHC
Reactivity:	Human, Mouse, Rat
Prediction:	Pig, Bovine, Horse, Sheep, Rabbit, Chicken, Xenopus
Mol.Wt.:	30 kDa; 30kD(Calculated).
Uniprot:	Q14469
RRID:	AB_2841062

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
100ul	$280	In stock
200ul	$350	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MS Report

HPLC Report

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

WB 1:1000-3000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human,Mouse,Rat

Prediction:

Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Chicken(100%), Xenopus(92%)

Clonality:

Polyclonal

Specificity:

HES1 Antibody detects endogenous levels of total HES1.

RRID:

AB_2841062
Cite Format: Affinity Biosciences Cat# DF7569, RRID:AB_2841062.

Conjugate:

Unconjugated.

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

bHLHb39; C-HAIRY1; c-hairy1A; Class B basic helix-loop-helix protein 39; FLJ20408; Hairy and enhancer of split 1 (Drosophila); Hairy and enhancer of split 1; Hairy homolog (Drosophila); Hairy homolog; Hairy like; Hairy, Drosophila, homolog of; Hairy-like protein; Hairy/enhancer of split, Drosophila, homolog of, 1; HAIRY1; HES-1; hes1; Hes1 hairy and enhancer of split 1 (Drosophila); HES1_HUMAN; HHL; HL; HRY; MGC129109; OTTHUMP00000209031; RHL; Transcription factor HES-1;

Immunogens

Immunogen:

Uniprot:

Q14469(HES1_HUMAN) >>Visit HPA database.

Gene(ID):

HES1(3280)

Sequence:

Q14469 HES1_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAPFAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species

Results

Score

Pig

100

Horse

100

Bovine

100

Sheep

100

Chicken

100

Rabbit

100

Xenopus

Dog

Zebrafish

Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - Q14469 As Substrate

Q14469

Site	PTM Type	Enzyme	Source
S10	Phosphorylation		Uniprot
S11	Phosphorylation		Uniprot
S12	Phosphorylation		Uniprot
T24	Phosphorylation		Uniprot
S32	Phosphorylation		Uniprot
S37	Phosphorylation	P17252 (PRKCA)	Uniprot
S38	Phosphorylation	P17252 (PRKCA)	Uniprot
S55	Phosphorylation		Uniprot
T59	Phosphorylation		Uniprot
K77	Ubiquitination		Uniprot
K86	Ubiquitination		Uniprot
T97	Phosphorylation		Uniprot
K109	Ubiquitination		Uniprot

Research Backgrounds

Q14469_HES1_HUMAN

Function:

Transcriptional repressor of genes that require a bHLH protein for their transcription. May act as a negative regulator of myogenesis by inhibiting the functions of MYOD1 and ASH1. Binds DNA on N-box motifs: 5'-CACNAG-3' with high affinity and on E-box motifs: 5'-CANNTG-3' with low affinity (By similarity). May play a role in a functional FA core complex response to DNA cross-link damage, being required for the stability and nuclear localization of FA core complex proteins, as well as for FANCD2 monoubiquitination in response to DNA damage.

Subcellular Location:

Nucleus.

Subunit Structure:

Transcription repression requires formation of a complex with a corepressor protein of the Groucho/TLE family. Interacts (via WPRW motif) with TLE1, and more weakly with TLE2. Interacts with HES6 (By similarity). Interacts with SIRT1. Interacts with an FA complex, composed of FANCA, FANCF, FANCG and FANCL, but not of FANCC, nor FANCE.

Family&Domains:

Has a particular type of basic domain (presence of a helix-interrupting proline) that binds to the N-box (CACNAG), rather than the canonical E-box (CANNTG).

The C-terminal WRPW motif is a transcriptional repression domain necessary for the interaction with Groucho/TLE family members, transcriptional corepressors recruited to specific target DNA by Hairy-related proteins.

The bHLH, as well as cooperation between the central Orange domain and the C-terminal WRPW motif, is required for transcriptional repressor activity.

Research Fields

· Environmental Information Processing > Signal transduction > Notch signaling pathway. (View pathway)

· Genetic Information Processing > Replication and repair > Fanconi anemia pathway.

· Human Diseases > Endocrine and metabolic diseases > Maturity onset diabetes of the young.

· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.

· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)

· Human Diseases > Cancers: Specific types > Breast cancer. (View pathway)

References

1). Notch1 contributes to TNF-α-induced proliferation and migration of airway smooth muscle cells through regulation of the Hes1/PTEN axis. International Immunopharmacology, 2020 (PubMed: 32871474) [IF=5.6]

Application: WB Species: mouse Sample: ASM cells

Fig. 5.| Notch1 knockdown decreased Hes1 and increased PTEN expression in TNF-α-induced ASM cells. ASM cells were transfected with NC or Notch1 siRNA for 48 h and then stimulated with TNF-α for 24 h. (D, E) Protein expression of Hes1 was examined by western blot.

2). Neural stem cell-derived exosomes regulate neural stem cell differentiation through miR-9-Hes1 axis. Frontiers in Cell and Developmental Biology, 2021 (PubMed: 34055767) [IF=5.5]

Application: WB Species: mouse Sample: NSCs

FIGURE 7 | Hes1 expression is negatively regulated by miR-9 in NSCs.(C) Representative western blotting results showing the expression of Hes1 and β-actin proteins in either agomiR-C- or agomiR-9-transfected NSCs.

3). TMT-based quantitative proteomics analysis reveals the role of Notch signaling in FAdV-4-infected LMH cell. Frontiers in Microbiology, 2022 (PubMed: 36187945) [IF=5.2]

4). The regulatory roles of VEGF-Notch signaling pathway on aplastic anemia with kidney deficiency and blood stasis. JOURNAL OF CELLULAR BIOCHEMISTRY, 2019 (PubMed: 30230583) [IF=4.0]

Application: WB Species: human Sample: HUVECs

FIGURE 5| The expression of VEGF‐Notch signaling pathway related proteins (VEGF, VEGFR, Notch‐1, Jagged1, Delta‐like1, and hes1)in HUVECs cocultured with VEGF/Notch shRNA transfected BMSCs (n = 3). *P < 0.05 vs HUVECs (normal control); #P < 0.05 vs BMSC + NC shRNA + HUVEC. BMSC, bone marrow mesenchymal stem cell; HUVEC, human umbilical vein endothelial cell; NC, normal control; shRNA, short hairpin RNA; VEGF, vascular endothelial growth factor; VEGFR, VEGF receptor

5). Minocycline Attenuates Sevoflurane-Induced Postoperative Cognitive Dysfunction in Aged Mice by Suppressing Hippocampal Apoptosis and the Notch Signaling Pathway-Mediated Neuroinflammation. Brain Sciences, 2023 (PubMed: 36979321) [IF=3.3]

Application: WB Species: Mouse Sample: hippocampal tissue

Figure 6 Minocycline alleviates sevoflurane-induced neuroinflammation via Notch signaling suppression: (A) Cell immunofluorescence was performed to assess Notch signaling-associated proteins in BV2 cells of each group. Scale bar, 20 μm; (B–G) Immunoblot detection of Notch1, cleaved Notch1, and Hes1 in BV2 cells and hippocampal tissue specimens. β-actin was utilized for normalizing data quantitated by densitometry with ImageJ. Data are mean ± SEM.

6). Astragalus Polysaccharide Promotes Neuronal Injury Repair via the Notch1/NFκB Signaling Axis in the Ventroposterior Thalamic Nucleus in Rats with Focal Cerebral Ischemia. Journal of integrative neuroscience, 2024 (PubMed: 38419443) [IF=1.8]

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

HES1 Antibody - #DF7569