Product: Phospho-PDHA1/2 (Ser293/Ser291) Antibody
Catalog: AF8502
Description: Rabbit polyclonal antibody to Phospho-PDHA1/2 (Ser293/Ser291)
Application: WB IHC IF/ICC
Cited expt.: WB, IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Chicken, Xenopus
Mol.Wt.: 43 kDa; 43kD(Calculated).
Uniprot: P08559 | P29803
RRID: AB_2840556

View similar products>>

   Size Price Inventory
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Chicken(100%), Xenopus(100%)
Clonality:
Polyclonal
Specificity:
Phospho-PDHA1/2 (Ser293/Ser291) Antibody detects endogenous levels of PDHA1/2 only when phosphorylated at Ser293/291.
RRID:
AB_2840556
Cite Format: Affinity Biosciences Cat# AF8502, RRID:AB_2840556.
Conjugate:
Unconjugated.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

ODPA_HUMAN; PDH; PDHA; PDHA1; PDHCE1A; PDHE1 A type I; PDHE1-A type I; PHE1A; Pyruvate Dehydrogenase (lipoamide) alpha 1; Pyruvate dehydrogenase complex, E1 alpha polypeptide 1; Pyruvate Dehydrogenase E1 alpha; Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial; EC 1.2.4.1; MGC149517; MGC149518; mitochondrial; ODPAT_HUMAN; Pdha2; PDHAL; PDHE1 A type II; PDHE1-A type II; Pyruvate dehydrogenase (lipoamide) alpha 2; Pyruvate dehydrogenase E1 component subunit alpha; Pyruvate dehydrogenase E1 component subunit alpha, testis specific form, mitochondrial; Pyruvate dehydrogenase, E1 alpha polypeptide, testis spec; testis-specific form;

Immunogens

Immunogen:

A synthesized peptide derived from human PDHA1/2 around the phosphorylation site of Ser293/291.

Uniprot:
Gene(ID):
Expression:
P08559 ODPA_HUMAN:

Ubiquitous.

P29803 ODPAT_HUMAN:

Testis. Expressed in postmeiotic spermatogenic cells.

Sequence:
MRKMLAAVSRVLSGASQKPASRVLVASRNFANDATFEIKKCDLHRLEEGPPVTTVLTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTGRKGGCAKGKGGSMHMYAKNFYGGNGIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERAAASTDYYKRGDFIPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHSMSDPGVSYRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIYSSDPPFEVRGANQWIKFKSVS

MLAAFISRVLRRVAQKSARRVLVASRNSSNDATFEIKKCDLYLLEEGPPVTTVLTRAEGLKYYRMMLTVRRMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHGVCYTRGLSVRSILAELTGRRGGCAKGKGGSMHMYTKNFYGGNGIVGAQGPLGAGIALACKYKGNDEICLTLYGDGAANQGQIAEAFNMAALWKLPCVFICENNLYGMGTSTERAAASPDYYKRGNFIPGLKVDGMDVLCVREATKFAANYCRSGKGPILMELQTYRYHGHSMSDPGVSYRTREEIQEVRSKRDPIIILQDRMVNSKLATVEELKEIGAEVRKEIDDAAQFATTDPEPHLEELGHHIYSSDSSFEVRGANPWIKFKSVS

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Xenopus
100
Chicken
100
Rabbit
100
Dog
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2), and thereby links the glycolytic pathway to the tricarboxylic cycle.

PTMs:

Phosphorylation at Ser-232, Ser-293 and Ser-300 by PDK family kinases inactivates the enzyme; for this phosphorylation at a single site is sufficient. Dephosphorylation at all three sites, i.e. at Ser-232, Ser-293 and Ser-300, is required for reactivation.

Acetylation alters the phosphorylation pattern. Deacetylated by SIRT3 (By similarity).

Subcellular Location:

Mitochondrion matrix.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Ubiquitous.

Function:

The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2), and thereby links the glycolytic pathway to the tricarboxylic cycle.

PTMs:

Phosphorylation at Ser-291, Ser-293 and Ser-298 by PDK family kinases inactivates the enzyme; for this phosphorylation at a single site is sufficient. Phosphorylation at Ser-293 interferes with access to active site, and thereby inactivates the enzyme. Dephosphorylation at all three sites, i.e. at Ser-291, Ser-293 and Ser-298, is required for reactivation.

Subcellular Location:

Mitochondrion matrix.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Testis. Expressed in postmeiotic spermatogenic cells.

Research Fields

· Environmental Information Processing > Signal transduction > HIF-1 signaling pathway.   (View pathway)

· Human Diseases > Cancers: Overview > Central carbon metabolism in cancer.   (View pathway)

· Metabolism > Carbohydrate metabolism > Glycolysis / Gluconeogenesis.

· Metabolism > Carbohydrate metabolism > Citrate cycle (TCA cycle).

· Metabolism > Carbohydrate metabolism > Pyruvate metabolism.

· Metabolism > Global and overview maps > Metabolic pathways.

· Metabolism > Global and overview maps > Carbon metabolism.

· Organismal Systems > Endocrine system > Glucagon signaling pathway.

References

1). β-hydroxybutyrate impairs bovine oocyte maturation via pyruvate dehydrogenase (PDH) associated energy metabolism abnormality. Frontiers in pharmacology, 2023 (PubMed: 37637420) [IF=5.6]

Application: WB    Species: bovine    Sample:

FIGURE 4. βHB exposure can reduce PDH activity on bovine oocyte maturation. (A) Representative images of Phospho-PDH (p-PDH). Green, p-PDH; blue, Hoechst. p-PDH protein and hoechst stained nuclei is represented in merge. Bar = 20 µm. (B) The relative fluorescence intensity of p-PDH of oocytes with or without βHB exposure. (C) Representative images of PDHA1. Green, PDHA1; blue, Hoechst. PDHA1 protein and hoechst stained nuclei is represented in merge. Bar = 20 µm. (D) The relative fluorescence intensity of PDHA1 of oocytes with or without βHB exposure. (E) p-PDH and PDH expression in bovine oocytes treated with βHB (0mM; 3.6 mM. Beta-actin was employed as protein loading control. (F) Representative Western blot of p-PDH/PDH in bovine oocytes stimulated with 3.6 mM βHB. (G) Representative images of SCOT. Green, SCOT; blue, Hoechst. SCOT protein and hoechst stained nuclei is represented in merge. Bar = 20 µm. (H) The relative fluorescence intensity of SCOT of oocytes with or without βHB exposure. Significant difference (****, p < 0.000; ***, p < 0.001; **, p < 0.01; *, p < 0.05).

Application: IF/ICC    Species: bovine    Sample:

FIGURE 4. βHB exposure can reduce PDH activity on bovine oocyte maturation. (A) Representative images of Phospho-PDH (p-PDH). Green, p-PDH; blue, Hoechst. p-PDH protein and hoechst stained nuclei is represented in merge. Bar = 20 µm. (B) The relative fluorescence intensity of p-PDH of oocytes with or without βHB exposure. (C) Representative images of PDHA1. Green, PDHA1; blue, Hoechst. PDHA1 protein and hoechst stained nuclei is represented in merge. Bar = 20 µm. (D) The relative fluorescence intensity of PDHA1 of oocytes with or without βHB exposure. (E) p-PDH and PDH expression in bovine oocytes treated with βHB (0mM; 3.6 mM. Beta-actin was employed as protein loading control. (F) Representative Western blot of p-PDH/PDH in bovine oocytes stimulated with 3.6 mM βHB. (G) Representative images of SCOT. Green, SCOT; blue, Hoechst. SCOT protein and hoechst stained nuclei is represented in merge. Bar = 20 µm. (H) The relative fluorescence intensity of SCOT of oocytes with or without βHB exposure. Significant difference (****, p < 0.000; ***, p < 0.001; **, p < 0.01; *, p < 0.05).

2). HIF-1 regulates energy metabolism of the Tibetan chicken brain during embryo development under hypoxia. American Journal of Physiology-Regulatory, Integrative and Comparative Physiology, 2021 (PubMed: 33596720) [IF=2.2]

Application: WB    Species: chicken    Sample:

Figure 5. Protein expression results of related genes during hypoxia at different developmental stages of the Tibetan chicken (TBC) and Dwarf Laying Chicken (DLC) embryonic brain. A–C: Western blot results of related genes in TBCs (A and B) and DLCs (C) under hypoxia as the embryo develops. D: chromatin immunoprecipitation (ChIP) assay of hypoxia-inducible factor-1 (HIF-1) binding to hexokinase 1 (HK1) and lactate dehydrogenase A (LDHA) was performed on the chicken embryonic brain. HTBC, TBCs under hypoxia; HDLC, DLCs under hypoxia. Data are presented as means ± SE.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.