Phospho-ATF4 (Ser219) Antibody | Affinity Biosciences

pElisa

1/1

Product:	Phospho-ATF4 (Ser219) Antibody
Catalog:	AF8097
Description:	Rabbit polyclonal antibody to Phospho-ATF4 (Ser219)
Application:	WB
Reactivity:	Human, Mouse, Rat
Prediction:	Pig, Zebrafish, Bovine, Sheep, Dog, Xenopus
Mol.Wt.:	39~49kD; 39kD(Calculated).
Uniprot:	P18848
RRID:	AB_2840160

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
100ul	$350	In stock
200ul	$450	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

WB 1:1000-3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human,Mouse,Rat

Prediction:

Pig(100%), Zebrafish(83%), Bovine(100%), Sheep(100%), Dog(100%), Xenopus(100%)

Clonality:

Polyclonal

Specificity:

Phospho-ATF4 (Ser219) Antibody detects endogenous levels of ATF4 only when phosphorylated at Ser219.

RRID:

AB_2840160
Cite Format: Affinity Biosciences Cat# AF8097, RRID:AB_2840160.

Conjugate:

Unconjugated.

Purification:

The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

Activating transcription factor 4; ATF 4; ATF4; ATF4 protein; ATF4_HUMAN; cAMP-dependent transcription factor ATF-4; cAMP-responsive element-binding protein 2; CREB 2; CREB-2; CREB2; Cyclic AMP dependent transcription factor ATF 4; Cyclic AMP response element binding protein 2; Cyclic AMP-dependent transcription factor ATF-4; Cyclic AMP-responsive element-binding protein 2; DNA binding protein TAXREB67; DNA-binding protein TAXREB67; Tax Responsive Enhancer Element B67; Tax-responsive enhancer element-binding protein 67; TaxREB67; TXREB;

Immunogens

Immunogen:

Uniprot:

P18848(ATF4_HUMAN) >>Visit HPA database.

Gene(ID):

ATF4(468)

Sequence:

P18848 ATF4_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species

Results

Score

Pig

100

Bovine

100

Sheep

100

Dog

100

Xenopus

100

Zebrafish

Horse

Chicken

Rabbit

Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P18848 As Substrate

P18848

Site	PTM Type	Enzyme	Source
K45	Sumoylation		Uniprot
K45	Ubiquitination		Uniprot
K53	Sumoylation		Uniprot
K53	Ubiquitination		Uniprot
K55	Ubiquitination		Uniprot
S69	Phosphorylation		Uniprot
K75	Ubiquitination		Uniprot
K88	Ubiquitination		Uniprot
T107	Phosphorylation	P07949 (RET)	Uniprot
T114	Phosphorylation	P07949 (RET)	Uniprot
T115	Phosphorylation	P07949 (RET)	Uniprot
T119	Phosphorylation	P07949 (RET)	Uniprot
S215	Phosphorylation		Uniprot
S219	Phosphorylation		Uniprot
S224	Phosphorylation		Uniprot
S245	Phosphorylation	P51812 (RPS6KA3)	Uniprot
S248	Phosphorylation		Uniprot
K259	Ubiquitination		Uniprot
K267	Sumoylation		Uniprot
K267	Ubiquitination		Uniprot
K277	Ubiquitination		Uniprot
T293	Phosphorylation		Uniprot
Y295	Phosphorylation		Uniprot
K299	Ubiquitination		Uniprot
K311	Acetylation	PR:000007102 (EP300)	Uniprot
K329	Ubiquitination		Uniprot
K335	Ubiquitination		Uniprot
K343	Acetylation		Uniprot
K348	Acetylation		Uniprot

Research Backgrounds

P18848_ATF4_HUMAN

Function:

Transcriptional activator. Binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Cooperates with FOXO1 in osteoblasts to regulate glucose homeostasis through suppression of beta-cell production and decrease in insulin production (By similarity). It binds to a Tax-responsive enhancer element in the long terminal repeat of HTLV-I. Regulates the induction of DDIT3/CHOP and asparagine synthetase (ASNS) in response to endoplasmic reticulum (ER) stress. In concert with DDIT3/CHOP, activates the transcription of TRIB3 and promotes ER stress-induced neuronal apoptosis by regulating the transcriptional induction of BBC3/PUMA. Activates transcription of SIRT4. Regulates the circadian expression of the core clock component PER2 and the serotonin transporter SLC6A4. Binds in a circadian time-dependent manner to the cAMP response elements (CRE) in the SLC6A4 and PER2 promoters and periodically activates the transcription of these genes. During ER stress response, activates the transcription of NLRP1, possibly in concert with other factors.

PTMs:

Ubiquitinated by SCF(BTRC) in response to mTORC1 signal, followed by proteasomal degradation and leading to down-regulate expression of SIRT4.

Phosphorylated by NEK6 (By similarity). Phosphorylated on the betaTrCP degron motif at Ser-219, followed by phosphorylation at Thr-213, Ser-224, Ser-231, Ser-235 and Ser-248, promoting interaction with BTRC and ubiquitination. Phosphorylation is promoted by mTORC1 (By similarity).

Phosphorylated by NEK6.

Subcellular Location:

Cytoplasm. Cell membrane. Nucleus. Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome.
Note: Colocalizes with GABBR1 in hippocampal neuron dendritic membranes (By similarity). Colocalizes with NEK6 at the centrosome (PubMed:20873783).

Subunit Structure:

Binds DNA as a homodimer and as a heterodimer. Interacts with CEBPB and binds DNA as a heterodimer with CEBPB. Interacts (via its leucine zipper domain) with GABBR1 and GABBR2 (via their C-termini). Interacts (via its DNA binding domain) with FOXO1 (C-terminal half); the interaction occurs in osteoblasts and regulates glucose homeostasis through suppression of beta-cell proliferation and a decrease in insulin production. Interacts with SATB2; the interaction results in enhanced DNA binding and transactivation by these transcription factors (By similarity). Interacts with CEP290 (via an N-terminal region). Interacts with NEK6, DAPK2 (isoform 2) and ZIPK/DAPK3. Forms a heterodimer with TXLNG in osteoblasts. Interacts with DDIT3/CHOP. Interacts with ABRAXAS2.

Family&Domains:

The BetaTrCP degron motif promotes binding to BTRC when phosphorylated.

Belongs to the bZIP family.

Research Fields

· Cellular Processes > Cell growth and death > Apoptosis. (View pathway)

· Environmental Information Processing > Signal transduction > MAPK signaling pathway. (View pathway)

· Environmental Information Processing > Signal transduction > cGMP-PKG signaling pathway. (View pathway)

· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway. (View pathway)

· Environmental Information Processing > Signal transduction > TNF signaling pathway. (View pathway)

· Genetic Information Processing > Folding, sorting and degradation > Protein processing in endoplasmic reticulum. (View pathway)

· Human Diseases > Endocrine and metabolic diseases > Non-alcoholic fatty liver disease (NAFLD).

· Human Diseases > Substance dependence > Cocaine addiction.

· Human Diseases > Substance dependence > Amphetamine addiction.

· Human Diseases > Substance dependence > Alcoholism.

· Human Diseases > Infectious diseases: Viral > Hepatitis B.

· Human Diseases > Infectious diseases: Viral > HTLV-I infection.

· Human Diseases > Cancers: Overview > Viral carcinogenesis.

· Human Diseases > Cancers: Specific types > Prostate cancer. (View pathway)

· Organismal Systems > Aging > Longevity regulating pathway. (View pathway)

· Organismal Systems > Circulatory system > Adrenergic signaling in cardiomyocytes. (View pathway)

· Organismal Systems > Nervous system > Long-term potentiation.

· Organismal Systems > Nervous system > Neurotrophin signaling pathway. (View pathway)

· Organismal Systems > Nervous system > Cholinergic synapse.

· Organismal Systems > Nervous system > Dopaminergic synapse.

· Organismal Systems > Endocrine system > Insulin secretion. (View pathway)

· Organismal Systems > Endocrine system > Estrogen signaling pathway. (View pathway)

· Organismal Systems > Endocrine system > Thyroid hormone synthesis.

· Organismal Systems > Endocrine system > Glucagon signaling pathway.

· Organismal Systems > Endocrine system > Aldosterone synthesis and secretion.

· Organismal Systems > Endocrine system > Relaxin signaling pathway.

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

Phospho-ATF4 (Ser219) Antibody - #AF8097