TF2H2 Antibody - #AF0595
Product: | TF2H2 Antibody |
Catalog: | AF0595 |
Description: | Rabbit polyclonal antibody to TF2H2 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Dog, Chicken, Xenopus |
Mol.Wt.: | 62kDa; 44kD(Calculated). |
Uniprot: | Q13888 |
RRID: | AB_2834253 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0595, RRID:AB_2834253.
Fold/Unfold
Basic transcription factor 2 44 kDa subunit; BTF2; BTF2 p44; BTF2-p44; BTF2P44; General transcription factor IIH; General transcription factor IIH polypeptide 2; General transcription factor IIH subunit 2; General transcription factor IIH, polypeptide 2, 44kDa; Gtf2h2; MGC102806; p44; T BTF2P44; T-BTF2P44; TF2H2_HUMAN; TFIIH; TFIIH basal transcription factor complex p44 subunit;
Immunogens
- Q13888 TF2H2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVCAVCQNVFCVDCDVFVHDSLHCCPGCIHKIPAPSGV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q13888 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y15 | Phosphorylation | Uniprot | |
K23 | Ubiquitination | Uniprot | |
K31 | Ubiquitination | Uniprot | |
K40 | Methylation | Uniprot | |
K40 | Ubiquitination | Uniprot | |
K77 | Ubiquitination | Uniprot | |
Y90 | Phosphorylation | Uniprot | |
K116 | Ubiquitination | Uniprot | |
K126 | Ubiquitination | Uniprot | |
K132 | Ubiquitination | Uniprot | |
K133 | Ubiquitination | Uniprot | |
S237 | Phosphorylation | Uniprot | |
K297 | Ubiquitination | Uniprot | |
K306 | Ubiquitination | Uniprot |
Research Backgrounds
Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module CAK controls the initiation of transcription. The N-terminus of GTF2H2 interacts with and regulates XPD whereas an intact C-terminus is required for a successful escape of RNAP II form the promoter.
Nucleus.
Widely expressed, with higher expression in skeletal muscle.
Component of the TFIID-containing RNA polymerase II pre-initiation complex that is composed of TBP and at least GTF2A1, GTF2A2, GTF2E1, GTF2E2, GTF2F1, GTF2H2, GTF2H3, GTF2H4, GTF2H5, GTF2B, TCEA1, ERCC2 and ERCC3. Component of the 7-subunit TFIIH core complex composed of XPB/ERCC3, XPD/ERCC2, GTF2H1, GTF2H2, GTF2H3, GTF2H4 and GTF2H5, which is active in NER. The core complex associates with the 3-subunit CDK-activating kinase (CAK) module composed of CCNH/cyclin H, CDK7 and MNAT1 to form the 10-subunit holoenzyme (holo-TFIIH) active in transcription. Interacts with XPB, XPD, GTF2H1 and GTF2H3.
(Microbial infection) Interacts with varicella-zoster virus IE63 protein.
Belongs to the GTF2H2 family.
Research Fields
· Genetic Information Processing > Transcription > Basal transcription factors.
· Genetic Information Processing > Replication and repair > Nucleotide excision repair.
· Human Diseases > Cancers: Overview > Viral carcinogenesis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.