NDUC2 Antibody - #AF0351

(2)  
Product: NDUC2 Antibody
Catalog: AF0351
Description: Rabbit polyclonal antibody to NDUC2
Application: WB IHC
Reactivity: Human, Rat
Mol.Wt.: 14kDa; 14kD(Calculated).
Uniprot: O95298
RRID: AB_2834196

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
IHC 1:50-1:200, WB 1:500-1:2000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Rat
Clonality:
Polyclonal
Specificity:
NDUC2 Antibody detects endogenous levels of total NDUC2.
RRID:
AB_2834196
Cite Format: Affinity Biosciences Cat# AF0351, RRID:AB_2834196.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

B14.5b; CI-B14.5b; Complex I B14.5b; Complex I subunit B14.5b; Complex I-B14.5b; HLC-1; HLC1; Human lung cancer oncogene 1 protein; NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2, 14.5kDa; NADH dehydrogenase [ubiquinone] 1 subunit C2; NADH dehydrogenase ubiquinone 1 subunit C2; NADH ubiquinone oxidoreductase subunit B14.5b; NADH-ubiquinone oxidoreductase subunit B14.5b; NADHDH2; NDUC2_HUMAN; NDUFC2;

Immunogens

Immunogen:

A synthesized peptide derived from human NDUC2, corresponding to a region within C-terminal amino acids.

Uniprot:

O95298(NDUC2_HUMAN) >>Visit HPA database.

Gene(ID):
NDUFC2(4718)
Description:
NDUFC2 Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Belongs to the complex I NDUFC2 subunit family. Complex I is composed of 45 different subunits.
Sequence:
MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR

PTMs - O95298 As Substrate

Site PTM Type Enzyme
S19 Phosphorylation
T54 Phosphorylation
Y80 Phosphorylation
K94 Ubiquitination
K105 Ubiquitination
K106 Ubiquitination
K114 Acetylation
K114 Sumoylation
K114 Ubiquitination

Research Backgrounds

Function:

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Subcellular Location:

Mitochondrion inner membrane>Single-pass membrane protein>Matrix side.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Complex I is composed of 45 different subunits.

Family&Domains:

Belongs to the complex I NDUFC2 subunit family.

Research Fields

· Human Diseases > Endocrine and metabolic diseases > Non-alcoholic fatty liver disease (NAFLD).

· Human Diseases > Neurodegenerative diseases > Alzheimer's disease.

· Human Diseases > Neurodegenerative diseases > Parkinson's disease.

· Human Diseases > Neurodegenerative diseases > Huntington's disease.

· Metabolism > Energy metabolism > Oxidative phosphorylation.

· Metabolism > Global and overview maps > Metabolic pathways.

· Organismal Systems > Nervous system > Retrograde endocannabinoid signaling.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.