CDKA2 Antibody - #AF0350
| Product: | CDKA2 Antibody |
| Catalog: | AF0350 |
| Description: | Rabbit polyclonal antibody to CDKA2 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse |
| Mol.Wt.: | 13kDa; 13kD(Calculated). |
| Uniprot: | O75956 |
| RRID: | AB_2834190 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0350, RRID:AB_2834190.
Fold/Unfold
CDK2 associated protein 2; CDK2-associated protein 2; CDK2AP2; CDKA2_HUMAN; Cyclin dependent kinase 2 associated protein 2; Cyclin-dependent kinase 2-associated protein 2; DOC 1 related protein; DOC-1-related protein; DOC-1R; DOC1R; FLJ10636; p14; tumor suppressor deleted in oral cancer related 1;
Immunogens
A synthesized peptide derived from human CDKA2, corresponding to a region within C-terminal amino acids.
- O75956 CDKA2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART
PTMs - O75956 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K96 | Ubiquitination | Uniprot | |
| S97 | Phosphorylation | Uniprot |
Research Backgrounds
Plays a role in regulating the self-renewal of embryonic stem cells (ESCs) and in maintaining cell survival during terminal differentiation of ESCs. Regulates microtubule organization of metaphase II oocytes (By similarity). Inhibits cell cycle G1/S phase transition by repressing CDK2 expression and activation; represses CDK2 activation by inhibiting its interaction with cyclin E and A.
Phosphorylated by MAPK1 and CDK2.
Cytoplasm. Nucleus.
Note: Accumulates in immature oocytes in the nucleus. During the first meiotic division, accumulates in the cytoplasm and localizes in dots in the vicinity of the chromosomes in a region enriched in microtubules.
Ubiquitous.
Interacts with CDK2AP1. Interacts with CDK2. Interacts with MAPK1 (By similarity).
Belongs to the CDK2AP family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.