Product: Collagen I Antibody
Catalog: AF0134
Description: Rabbit polyclonal antibody to Collagen I
Application: WB IHC IF/ICC
Cited expt.: WB, IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Dog
Mol.Wt.: 129kDa; 139kD,129kD(Calculated).
Uniprot: P02452 | P08123
RRID: AB_2813771

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Dog(100%)
Clonality:
Polyclonal
Specificity:
Collagen I Antibody detects endogenous levels of total Collagen I.
RRID:
AB_2813771
Cite Format: Affinity Biosciences Cat# AF0134, RRID:AB_2813771.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Alpha 1 type I collagen; Alpha 2 type I collagen; alpha 2 type I procollagen; alpha 2(I) procollagen; alpha 2(I)-collagen; Alpha-1 type I collagen; alpha1(I) procollagen; CO1A1_HUMAN; COL1A1; COL1A2; collagen alpha 1 chain type I; Collagen alpha-1(I) chain; collagen alpha-1(I) chain preproprotein; Collagen I alpha 1 polypeptide; Collagen I alpha 2 polypeptide; collagen of skin, tendon and bone, alpha-1 chain; collagen of skin, tendon and bone, alpha-2 chain; Collagen type I alpha 1; Collagen type I alpha 2; EDSC; OI1; OI2; OI3; OI4; pro-alpha-1 collagen type 1; type I proalpha 1; type I procollagen alpha 1 chain; Type I procollagen;

Immunogens

Immunogen:

A synthesized peptide derived from human Collagen I, corresponding to a region within N-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
P02452 CO1A1_HUMAN:

Forms the fibrils of tendon, ligaments and bones. In bones the fibrils are mineralized with calcium hydroxyapatite.

P08123 CO1A2_HUMAN:

Forms the fibrils of tendon, ligaments and bones. In bones the fibrils are mineralized with calcium hydroxyapatite.

Description:
This gene encodes one of the chains for type I collagen, the fibrillar collagen found in most connective tissues. Mutations in this gene are associated with osteogenesis imperfecta, Ehlers-Danlos syndrome, idiopathic osteoporosis, and atypical Marfan syndrome. Symptoms associated with mutations in this gene, however, tend to be less severe than mutations in the gene for alpha-1 type I collagen since alpha-2 is less abundant. Multiple messages for this gene result from multiple polyadenylation signals, a feature shared by most of the other collagen genes.
Sequence:
MFSFVDLRLLLLLAATALLTHGQEEGQVEGQDEDIPPITCVQNGLRYHDRDVWKPEPCRICVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSESPTDQETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAPQLSYGYDEKSTGGISVPGPMGPSGPRGLPGPPGAPGPQGFQGPPGEPGEPGASGPMGPRGPPGPPGKNGDDGEAGKPGRPGERGPPGPQGARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGAPGQMGPRGLPGERGRPGAPGPAGARGNDGATGAAGPPGPTGPAGPPGFPGAVGAKGEAGPQGPRGSEGPQGVRGEPGPPGPAGAAGPAGNPGADGQPGAKGANGAPGIAGAPGFPGARGPSGPQGPGGPPGPKGNSGEPGAPGSKGDTGAKGEPGPVGVQGPPGPAGEEGKRGARGEPGPTGLPGPPGERGGPGSRGFPGADGVAGPKGPAGERGSPGPAGPKGSPGEAGRPGEAGLPGAKGLTGSPGSPGPDGKTGPPGPAGQDGRPGPPGPPGARGQAGVMGFPGPKGAAGEPGKAGERGVPGPPGAVGPAGKDGEAGAQGPPGPAGPAGERGEQGPAGSPGFQGLPGPAGPPGEAGKPGEQGVPGDLGAPGPSGARGERGFPGERGVQGPPGPAGPRGANGAPGNDGAKGDAGAPGAPGSQGAPGLQGMPGERGAAGLPGPKGDRGDAGPKGADGSPGKDGVRGLTGPIGPPGPAGAPGDKGESGPSGPAGPTGARGAPGDRGEPGPPGPAGFAGPPGADGQPGAKGEPGDAGAKGDAGPPGPAGPAGPPGPIGNVGAPGAKGARGSAGPPGATGFPGAAGRVGPPGPSGNAGPPGPPGPAGKEGGKGPRGETGPAGRPGEVGPPGPPGPAGEKGSPGADGPAGAPGTPGPQGIAGQRGVVGLPGQRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESGREGAPGAEGSPGRDGSPGAKGDRGETGPAGPPGAPGAPGAPGPVGPAGKSGDRGETGPAGPTGPVGPVGARGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGPPGSPGEQGPSGASGPAGPRGPPGSAGAPGKDGLNGLPGPIGPPGPRGRTGDAGPVGPPGPPGPPGPPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCRDLKMCHSDWKSGEYWIDPNQGCNLDAIKVFCNMETGETCVYPTQPSVAQKNWYISKNPKDKRHVWFGESMTDGFQFEYGGQGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQTGNLKKALLLQGSNEIEIRAEGNSRFTYSVTVDGCTSHTGAWGKTVIEYKTTKTSRLPIIDVAPLDVGAPDQEFGFDVGPVCFL

MLSFVDTRTLLLLAVTLCLATCQSLQEETVRKGPAGDRGPRGERGPPGPPGRDGEDGPTGPPGPPGPPGPPGLGGNFAAQYDGKGVGLGPGPMGLMGPRGPPGAAGAPGPQGFQGPAGEPGEPGQTGPAGARGPAGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGEIGAVGNAGPAGPAGPRGEVGLPGLSGPVGPPGNPGANGLTGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGLVGEPGPAGSKGESGNKGEPGSAGPQGPPGPSGEEGKRGPNGEAGSAGPPGPPGLRGSPGSRGLPGADGRAGVMGPPGSRGASGPAGVRGPNGDAGRPGEPGLMGPRGLPGSPGNIGPAGKEGPVGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPPGPPGFQGLPGPSGPAGEVGKPGERGLHGEFGLPGPAGPRGERGPPGESGAAGPTGPIGSRGPSGPPGPDGNKGEPGVVGAVGTAGPSGPSGLPGERGAAGIPGGKGEKGEPGLRGEIGNPGRDGARGAPGAVGAPGPAGATGDRGEAGAAGPAGPAGPRGSPGERGEVGPAGPNGFAGPAGAAGQPGAKGERGAKGPKGENGVVGPTGPVGAAGPAGPNGPPGPAGSRGDGGPPGMTGFPGAAGRTGPPGPSGISGPPGPPGPAGKEGLRGPRGDQGPVGRTGEVGAVGPPGFAGEKGPSGEAGTAGPPGTPGPQGLLGAPGILGLPGSRGERGLPGVAGAVGEPGPLGIAGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGNDGPPGRDGQPGHKGERGYPGNIGPVGAAGAPGPHGPVGPAGKHGNRGETGPSGPVGPAGAVGPRGPSGPQGIRGDKGEPGEKGPRGLPGLKGHNGLQGLPGIAGHHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGHPGTVGPAGIRGPQGHQGPAGPPGPPGPPGPPGVSGGGYDFGYDGDFYRADQPRSAPSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFK

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Dog
100
Sheep
0
Xenopus
0
Zebrafish
0
Chicken
0
Rabbit
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Type I collagen is a member of group I collagen (fibrillar forming collagen).

PTMs:

Contains mostly 4-hydroxyproline. Proline residues at the third position of the tripeptide repeating unit (G-X-Y) are hydroxylated in some or all of the chains.

Contains 3-hydroxyproline at a few sites. This modification occurs on the first proline residue in the sequence motif Gly-Pro-Hyp, where Hyp is 4-hydroxyproline.

Lysine residues at the third position of the tripeptide repeating unit (G-X-Y) are 5-hydroxylated in some or all of the chains.

O-glycosylated on hydroxylated lysine residues. The O-linked glycan consists of a Glc-Gal disaccharide.

Subcellular Location:

Secreted>Extracellular space>Extracellular matrix.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Forms the fibrils of tendon, ligaments and bones. In bones the fibrils are mineralized with calcium hydroxyapatite.

Family&Domains:

The C-terminal propeptide, also known as COLFI domain, have crucial roles in tissue growth and repair by controlling both the intracellular assembly of procollagen molecules and the extracellular assembly of collagen fibrils. It binds a calcium ion which is essential for its function (By similarity).

Belongs to the fibrillar collagen family.

Function:

Type I collagen is a member of group I collagen (fibrillar forming collagen).

PTMs:

Prolines at the third position of the tripeptide repeating unit (G-X-Y) are hydroxylated in some or all of the chains.

Subcellular Location:

Secreted>Extracellular space>Extracellular matrix.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Forms the fibrils of tendon, ligaments and bones. In bones the fibrils are mineralized with calcium hydroxyapatite.

Family&Domains:

The C-terminal propeptide, also known as COLFI domain, have crucial roles in tissue growth and repair by controlling both the intracellular assembly of procollagen molecules and the extracellular assembly of collagen fibrils. It binds a calcium ion which is essential for its function.

Belongs to the fibrillar collagen family.

Research Fields

· Cellular Processes > Cellular community - eukaryotes > Focal adhesion.   (View pathway)

· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.   (View pathway)

· Environmental Information Processing > Signaling molecules and interaction > ECM-receptor interaction.   (View pathway)

· Human Diseases > Infectious diseases: Parasitic > Amoebiasis.

· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.

· Organismal Systems > Immune system > Platelet activation.   (View pathway)

· Organismal Systems > Endocrine system > Relaxin signaling pathway.

· Organismal Systems > Digestive system > Protein digestion and absorption.

References

1). Modified citrus pectin ameliorates myocardial fibrosis and inflammation via suppressing galectin-3 and TLR4/MyD88/NF-κB signaling pathway. Biomedicine & Pharmacotherapy, 2020 (PubMed: 32172066) [IF=6.9]

Application: IHC    Species: rat    Sample: heart

Fig. 5. |Effects of MCP on ISO-induced myocardial fibrosis in rats. (A and B) Immunohistochemical analysis of collagen I and collagen Ⅲ protein in heart cross sections of different groups on day 15 and day 22 (200× magnification). Scale bars 100 μm.

Application: WB    Species: rat    Sample: heart

Fig. 6. |Effects of MCP on the expression of collagen Ⅰ and collagen Ⅲ induced by ISO in rats. Protein and mRNA levels of collagen Ⅰ and collagen Ⅲ were analyzed by western blot and qRT-PCR in each group on day 15 and day 22. (A) Protein expression of collagen Ⅰ and collagen Ⅲ were measured by western blot.

2). Cyclic helix B peptide promotes random‐pattern skin flap survival via TFE3‐mediated enhancement of autophagy and reduction of ROS levels. British Journal of Pharmacology, 2022 (PubMed: 34622942) [IF=6.8]

3). Multi-omic analysis revealed the therapeutic mechanisms of Alpinia oxyphylla fructus water extract against bladder overactivity in spontaneously hypertensive rats. Phytomedicine : international journal of phytotherapy and phytopharmacology, 2024 (PubMed: 37976696) [IF=6.7]

4). Targeting the Akt/PI3K/mTOR signaling pathway for complete eradication of keloid disease by sunitinib. Apoptosis, 2022 (PubMed: 35802302) [IF=6.1]

5). Protein Expression Profile in Rat Silicosis Model Reveals Upregulation of PTPN2 and Its Inhibitory Effect on Epithelial-Mesenchymal Transition by Dephosphorylation of STAT3. International Journal of Molecular Sciences, 2020 (PubMed: 32054021) [IF=5.6]

Application: WB    Species: mouse    Sample: MLE‐12 cells

Figure 6.|Effect of PTPN2 overexpression on SiO2 stimulated MLE‐12 cells.(A)Immunofluorescent staining for PTPN2 and E‐cad expression in NC‐LW299 and LW1049 cells with SiO2; Scale bars: 50μm. (B) Immunofluorescent staining for Vimentin expression in NC‐LW299 and LW1049 cells with SiO2; Scale bars: 50 μm. (C) Western blot for the expression levels of PTPN2, E‐cad, Vimentin, and p‐STAT3 in NC‐LW299 and LW1049 cells with SiO2

6). Pulmozyme Ameliorates LPS-Induced Lung Fibrosis but Provokes Residual Inflammation by Modulating Cell-Free DNA Composition and Controlling Neutrophil Phenotype. Biomolecules, 2025 (PubMed: 40001601) [IF=5.5]

Application: IHC    Species: Mouse    Sample: lung tissue

Figure 3. Collagen I expression in the lung tissue of LPS-challenged mice without treatment and after Pulmozyme administration. (A). Representative immunohistochemical images of the lung sections of the control and experimental groups stained with anti-collagen I primary antibodies. Original magnification ×200. Green arrows indicate collagen I in the lungs. (B). The effect of Pulmozyme on collagen I expression in the lungs. The intensity of collagen I expression in the lungs of the control (black curves) and experimental (red curves) groups was assessed by a semiquantitative method, where 0—no pathological changes, 1—mild collagen I expression, 2—moderate collagen I expression, and 3—severe collagen I expression. Dotted lines show collagen I expression in the lungs of healthy animals. Statistically significant differences at * p < 0.05 relative to the control.

7). MiR-185-5p ameliorates endoplasmic reticulum stress and renal fibrosis by downregulation of ATF6. LABORATORY INVESTIGATION, 2020 (PubMed: 32514126) [IF=5.1]

Application: WB    Species: human    Sample: HK2 cells

Fig. 3| MiR-185-5p prevents extracellular matrix accumulation and dedifferentiation of TGF-β1-induced HK2 cells by downregulating ATF6. a Expression of fibronectin, collagen I, and collagen III, and quantitative analysis of relative protein expression.

8). Cardamonin attenuates iron overload-induced osteoblast oxidative stress through the HIF-1α/ROS pathway. International immunopharmacology, 2024 (PubMed: 39217878) [IF=4.8]

9). Optimized new Shengmai powder ameliorates myocardial fibrosis in rats with heart failure by inhibition of the MAPK signaling pathway. Journal of ethnopharmacology, 2024 (PubMed: 37739104) [IF=4.8]

Application: WB    Species: Rat    Sample:

Fig. 9. Effects of ONSMP on downstream proteins of MAPK signaling pathway. (A) Representative western blotting bands of p-c-Fos, p-c-Jun, LOX, CCND1, COL Ⅰ, COL Ⅲ, and α-SMA in the myocardium, with vinculin, and GAPDH as internal reference. (B–K) Statistical graphs of p-c-Fos, p-c-Jun, LOX, CCND1, COL Ⅰ, COL Ⅲ, and α-SMA (n = 3). Data are presented as mean ± SEM. nsP > 0.05; ▲▲P < 0.01 vs the sham; *P < 0.05, **P < 0.01 vs the model; ##P < 0.01 vs the ONSMP-L; ※P < 0.05, ※※P < 0.01 vs the ONSMP-M.

10). Decellularized Umbilical Cord as a Scaffold to Support Healing of Full-Thickness Wounds. Biomimetics (Basel, Switzerland), 2024 (PubMed: 39056846) [IF=4.5]

Application: WB    Species: Human    Sample:

Figure 2. A characterization of the native and decellularized human umbilical cord (UC-scaffold): (a) native tissue H&E staining (scale bar = 100 µm); (b) the UC-scaffold H&E staining (scale bar = 100 µm); (c) DNA content, ng per 1 mg of dry weight; (d) the macroscopic appearance of the scaffold; (e) scanning electron microscopy (SEM) image of the scaffold (scale bar = 1 mm); (f) transmission electronic microscopy (TEM) image of the native tissue (scale bar = 200 nm); (g) TEM image of the native tissue (scale bar = 100 nm); (h) TEM image of the scaffold (scale bar = 200 nm); (i) TEM image of the native tissue (scale bar = 100 nm); (j) content of type I collagen as measured via Western blotting; (k) native tissue Alcian blue staining (scale bar = 100 µm); (l) the UC-scaffold Alcian blue staining (scale bar = 100 µm); (m) Alcian blue staining after the UC-scaffold treatment with hyaluronidase (scale bar = 100 µm); (n) GAG content, µg per 1 mg of dry weight; (o) immunohistochemical staining for type IV collagen (scale bar = 100 µm); (p) immunohistochemical staining for laminin (scale bar = 100 µm); (q) immunohistochemical staining for fibronectin (scale bar = 100 µm); (r) content of TGF-β3 as measured via Western blotting; (s) content of VEGF as measured via Western blotting; (t) scaffold with hADSCs, 7 days of cultivation, LIVE/DEAD staining (scale bar = 100 µm); and (u) scaffold with hADSCs, 14 days of cultivation, LIVE/DEAD staining (scale bar = 100 µm).

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.