Phospho-VAV3 (Tyr173) Antibody - #AF0065
Product: | Phospho-VAV3 (Tyr173) Antibody |
Catalog: | AF0065 |
Description: | Rabbit polyclonal antibody to Phospho-VAV3 (Tyr173) |
Application: | WB |
Reactivity: | Human, Mouse |
Mol.Wt.: | 100kDa; 98kD(Calculated). |
Uniprot: | Q9UKW4 |
RRID: | AB_2834108 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0065, RRID:AB_2834108.
Fold/Unfold
FLJ40431; Guanine nucleotide exchange factor VAV3; Protein vav 3; Protein vav3; RGD1565941; VAV 3; Vav 3 guanine nucleotide exchange factor; VAV 3 oncogene; VAV 3 protein; VAV-3; Vav3; VAV3 oncogene; VAV3 protein; VAV3_HUMAN;
Immunogens
A synthesized peptide derived from human VAV3 around the phosphorylation site of Tyr173.
Isoform 1 and isoform 3 are widely expressed; both are expressed at very low levels in skeletal muscle. In keratinocytes, isoform 1 is less abundant than isoform 3. Isoform 3 is detected at very low levels, if any, in adrenal gland, bone marrow, spleen, fetal brain and spinal chord; in these tissues, isoform 1 is readily detectable.
- Q9UKW4 VAV3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEPWKQCAQWLIHCKVLPTNHRVTWDSAQVFDLAQTLRDGVLLCQLLNNLRAHSINLKEINLRPQMSQFLCLKNIRTFLTACCETFGMRKSELFEAFDLFDVRDFGKVIETLSRLSRTPIALATGIRPFPTEESINDEDIYKGLPDLIDETLVEDEEDLYDCVYGEDEGGEVYEDLMKAEEAHQPKCPENDIRSCCLAEIKQTEEKYTETLESIEKYFMAPLKRFLTAAEFDSVFINIPELVKLHRNLMQEIHDSIVNKNDQNLYQVFINYKERLVIYGQYCSGVESAISSLDYISKTKEDVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTTDPTEKANLKLALDAMKDLAQYVNEVKRDNETLREIKQFQLSIENLNQPVLLFGRPQGDGEIRITTLDKHTKQERHIFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIANNPTTDKENKKWSYGFYLIHTQGQNGLEFYCKTKDLKKKWLEQFEMALSNIRPDYADSNFHDFKMHTFTRVTSCKVCQMLLRGTFYQGYLCFKCGARAHKECLGRVDNCGRVNSGEQGTLKLPEKRTNGLRRTPKQVDPGLPKMQVIRNYSGTPPPALHEGPPLQLQAGDTVELLKGDAHSLFWQGRNLASGEVGFFPSDAVKPCPCVPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIKILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEHSAGQRGNRAGNSLLSPKVLGIAIARYDFCARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPSTYVEEDE
PTMs - Q9UKW4 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T131 | Phosphorylation | Uniprot | |
S134 | Phosphorylation | Uniprot | |
Y141 | Phosphorylation | Uniprot | |
Y173 | Phosphorylation | P12931 (SRC) | Uniprot |
K201 | Ubiquitination | Uniprot | |
K206 | Ubiquitination | Uniprot | |
Y207 | Phosphorylation | Uniprot | |
T208 | Phosphorylation | Uniprot | |
T210 | Phosphorylation | Uniprot | |
S213 | Phosphorylation | Uniprot | |
Y217 | Phosphorylation | Uniprot | |
Y294 | Phosphorylation | Uniprot | |
S296 | Phosphorylation | Uniprot | |
T298 | Phosphorylation | Uniprot | |
K311 | Ubiquitination | Uniprot | |
K317 | Ubiquitination | Uniprot | |
K333 | Ubiquitination | Uniprot | |
K343 | Ubiquitination | Uniprot | |
K351 | Ubiquitination | Uniprot | |
K355 | Ubiquitination | Uniprot | |
K362 | Ubiquitination | Uniprot | |
K372 | Ubiquitination | Uniprot | |
K414 | Ubiquitination | Uniprot | |
K435 | Ubiquitination | Uniprot | |
K442 | Ubiquitination | Uniprot | |
K451 | Ubiquitination | Uniprot | |
Y508 | Phosphorylation | Uniprot | |
S511 | Phosphorylation | Uniprot | |
K528 | Ubiquitination | Uniprot | |
Y539 | Phosphorylation | Uniprot | |
S567 | Phosphorylation | Uniprot | |
T572 | Phosphorylation | Uniprot | |
K574 | Ubiquitination | Uniprot | |
K588 | Ubiquitination | Uniprot | |
T606 | Phosphorylation | Uniprot | |
K656 | Ubiquitination | Uniprot | |
Y667 | Phosphorylation | Uniprot | |
Y706 | Phosphorylation | Uniprot | |
K717 | Ubiquitination | Uniprot | |
K720 | Ubiquitination | Uniprot | |
K735 | Methylation | Uniprot | |
K737 | Methylation | Uniprot | |
S738 | Phosphorylation | Uniprot | |
K747 | Ubiquitination | Uniprot | |
S750 | Phosphorylation | Uniprot | |
K752 | Ubiquitination | Uniprot | |
K767 | Ubiquitination | Uniprot | |
S783 | Phosphorylation | Uniprot | |
S786 | Phosphorylation | Uniprot | |
K788 | Ubiquitination | Uniprot | |
Y797 | Phosphorylation | Uniprot | |
K811 | Ubiquitination | Uniprot | |
K816 | Ubiquitination | Uniprot | |
Y818 | Phosphorylation | Uniprot | |
K820 | Ubiquitination | Uniprot | |
S840 | Phosphorylation | Uniprot | |
Y842 | Phosphorylation | Uniprot |
Research Backgrounds
Exchange factor for GTP-binding proteins RhoA, RhoG and, to a lesser extent, Rac1. Binds physically to the nucleotide-free states of those GTPases. Plays an important role in angiogenesis. Its recruitment by phosphorylated EPHA2 is critical for EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration and assembly (By similarity). May be important for integrin-mediated signaling, at least in some cell types. In osteoclasts, along with SYK tyrosine kinase, required for signaling through integrin alpha-v/beta-1 (ITAGV-ITGB1), a crucial event for osteoclast proper cytoskeleton organization and function. This signaling pathway involves RAC1, but not RHO, activation. Necessary for proper wound healing. In the course of wound healing, required for the phagocytotic cup formation preceding macrophage phagocytosis of apoptotic neutrophils. Responsible for integrin beta-2 (ITGB2)-mediated macrophage adhesion and, to a lesser extent, contributes to beta-3 (ITGB3)-mediated adhesion. Does not affect integrin beta-1 (ITGB1)-mediated adhesion (By similarity).
Phosphorylated. Phosphorylation can be mediated by ROS1. In osteoclasts, undergoes tyrosine phosphorylation in response to CSF1 (By similarity).
Isoform 1 and isoform 3 are widely expressed; both are expressed at very low levels in skeletal muscle. In keratinocytes, isoform 1 is less abundant than isoform 3. Isoform 3 is detected at very low levels, if any, in adrenal gland, bone marrow, spleen, fetal brain and spinal chord; in these tissues, isoform 1 is readily detectable.
Interacts with the PH domain of APS. Interacts (via SH2 domains) with the phosphorylated form of EPHA2. Interacts with ROS1; constitutive interaction that mediates VAV3 phosphorylation.
Research Fields
· Cellular Processes > Cellular community - eukaryotes > Focal adhesion. (View pathway)
· Cellular Processes > Cell motility > Regulation of actin cytoskeleton. (View pathway)
· Environmental Information Processing > Signal transduction > cAMP signaling pathway. (View pathway)
· Organismal Systems > Immune system > Chemokine signaling pathway. (View pathway)
· Organismal Systems > Immune system > Natural killer cell mediated cytotoxicity. (View pathway)
· Organismal Systems > Immune system > T cell receptor signaling pathway. (View pathway)
· Organismal Systems > Immune system > B cell receptor signaling pathway. (View pathway)
· Organismal Systems > Immune system > Fc epsilon RI signaling pathway. (View pathway)
· Organismal Systems > Immune system > Fc gamma R-mediated phagocytosis. (View pathway)
· Organismal Systems > Immune system > Leukocyte transendothelial migration. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.