Phospho-HCLS1 (Tyr378) Antibody | Affinity Biosciences

pElisa

1/1

Product:	Phospho-HCLS1 (Tyr378) Antibody
Catalog:	AF0063
Description:	Rabbit polyclonal antibody to Phospho-HCLS1 (Tyr378)
Application:	WB
Reactivity:	Human
Mol.Wt.:	78kDa; 54kD(Calculated).
Uniprot:	P14317
RRID:	AB_2834105

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
100ul	$280	In stock
200ul	$350	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

WB 1:500-1:2000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human

Clonality:

Polyclonal

Specificity:

Phospho-HCLS1 (Tyr378) Antibody detects endogenous levels of HCLS1 only when phosphorylated at Tyrosine 378.

RRID:

AB_2834105
Cite Format: Affinity Biosciences Cat# AF0063, RRID:AB_2834105.

Conjugate:

Unconjugated.

Purification:

The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

Cortactin like; CTTNL; HCLS 1; Hcls1; HCLS1_HUMAN; Hematopoietic cell specific Lyn substrate 1; Hematopoietic cell-specific LYN substrate 1; Hematopoietic lineage cell-specific protein; HS 1; HS1; LckBP1; OTTHUMP00000215180; OTTHUMP00000215182; p75;

Immunogens

Immunogen:

Uniprot:

P14317(HCLS1_HUMAN) >>Visit HPA database.

Gene(ID):

HCLS1(3059)

Expression:

P14317 HCLS1_HUMAN:

Expressed only in tissues and cells of hematopoietic origin.

Description:

Substrate of the antigen receptor-coupled tyrosine kinase. Plays a role in antigen receptor signaling for both clonal expansion and deletion in lymphoid cells. Directly associates with HAX-1, through binding to its C-terminal region. May also be involved in the regulation of gene expression.

Sequence:

P14317 HCLS1_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MWKSVVGHDVSVSVETQGDDWDTDPDFVNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGPKASHGYGGRFGVERDRMDKSAVGHEYVAEVEKHSSQTDAAKGFGGKYGVERDRADKSAVGFDYKGEVEKHTSQKDYSRGFGGRYGVEKDKWDKAALGYDYKGETEKHESQRDYAKGFGGQYGIQKDRVDKSAVGFNEMEAPTTAYKKTTPIEAASSGTRGLKAKFESMAEEKRKREEEEKAQQVARRQQERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVEEEPVYEAEPEPEPEPEPEPENDYEDVEEMDRHEQEDEPEGDYEEVLEPEDSSFSSALAGSSGCPAGAGAGAVALGISAVAVYDYQGEGSDELSFDPDDVITDIEMVDEGWWRGRCHGHFGLFPANYVKLLE

PTMs - P14317 As Substrate

P14317

Site	PTM Type	Enzyme	Source
S13	Phosphorylation		Uniprot
T16	Phosphorylation	P68400 (CSNK2A1)	Uniprot
T23	Phosphorylation	P68400 (CSNK2A1)	Uniprot
S32	Phosphorylation		Uniprot
K34	Ubiquitination		Uniprot
K41	Acetylation		Uniprot
K41	Ubiquitination		Uniprot
T42	Phosphorylation		Uniprot
K60	Ubiquitination		Uniprot
S62	Phosphorylation		Uniprot
Y83	Phosphorylation		Uniprot
S97	Phosphorylation		Uniprot
Y103	Phosphorylation		Uniprot
K118	Ubiquitination		Uniprot
K123	Acetylation		Uniprot
K123	Ubiquitination		Uniprot
Y124	Phosphorylation		Uniprot
S134	Phosphorylation		Uniprot
Y140	Phosphorylation		Uniprot
K141	Acetylation		Uniprot
Y153	Phosphorylation		Uniprot
S154	Phosphorylation		Uniprot
R155	Methylation		Uniprot
Y161	Phosphorylation		Uniprot
K170	Ubiquitination		Uniprot
Y175	Phosphorylation		Uniprot
Y177	Phosphorylation		Uniprot
T181	Phosphorylation		Uniprot
S186	Phosphorylation		Uniprot
Y190	Phosphorylation		Uniprot
K192	Acetylation		Uniprot
K192	Ubiquitination		Uniprot
Y198	Phosphorylation		Uniprot
S208	Phosphorylation		Uniprot
T219	Phosphorylation		Uniprot
T220	Phosphorylation		Uniprot
Y222	Phosphorylation	P07948 (LYN) , P09769 (FGR)	Uniprot
K223	Acetylation		Uniprot
K224	Acetylation		Uniprot
S232	Phosphorylation		Uniprot
K239	Ubiquitination		Uniprot
K241	Acetylation		Uniprot
T272	Phosphorylation		Uniprot
S275	Phosphorylation		Uniprot
T308	Phosphorylation		Uniprot
T333	Phosphorylation		Uniprot
Y360	Phosphorylation		Uniprot
Y378	Phosphorylation	P07948 (LYN) , P43405 (SYK)	Uniprot
Y397	Phosphorylation	P09769 (FGR) , P07948 (LYN) , P43405 (SYK)	Uniprot
Y481	Phosphorylation		Uniprot

Research Backgrounds

P14317_HCLS1_HUMAN

Function:

Substrate of the antigen receptor-coupled tyrosine kinase. Plays a role in antigen receptor signaling for both clonal expansion and deletion in lymphoid cells. May also be involved in the regulation of gene expression.

PTMs:

Phosphorylated by FES (By similarity). Phosphorylated by LYN, FYN and FGR after cross-linking of surface IgM on B-cells. Phosphorylation by LYN, FYN and FGR requires prior phosphorylation by SYK or FES.

Subcellular Location:

Membrane>Peripheral membrane protein. Cytoplasm. Mitochondrion.

Tissue Specificity:

Expressed only in tissues and cells of hematopoietic origin.

Subunit Structure:

Associates with the SH2 and SH3 domains of LCK. Binding to he LCK SH3 domain occurs constitutively, while binding to the LCK SH2 domain occurs only upon TCR stimulation. A similar binding pattern was observed with LYN, but not with FYN in which the FYN SH2 region associates upon TCR stimulation but the FYN SH3 region does not associate regardless of TCR stimulation. Directly associates with HAX1, through binding to its C-terminal region. Interacts with HS1BP3. Interacts with FES/FPS (By similarity). Interacts (via SH2 domain) with FGR. Forms a multiprotein complex with LYN and ANKRD54 (By similarity).

Research Fields

· Cellular Processes > Cellular community - eukaryotes > Tight junction. (View pathway)

· Human Diseases > Infectious diseases: Bacterial > Bacterial invasion of epithelial cells.

· Human Diseases > Infectious diseases: Bacterial > Pathogenic Escherichia coli infection.

· Human Diseases > Infectious diseases: Bacterial > Shigellosis.

· Human Diseases > Cancers: Overview > Proteoglycans in cancer.

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

Phospho-HCLS1 (Tyr378) Antibody - #AF0063